Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04258
Gene name
Locationscaffold_04:1792942..1795177
Strand-
Gene length (bp)2235
Transcript length (bp)1002
Coding sequence length (bp)1002
Protein length (aa) 334

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00153 Mito_carr Mitochondrial carrier protein 6.6E-09 9 78
PF00153 Mito_carr Mitochondrial carrier protein 7.1E-14 99 186
PF00153 Mito_carr Mitochondrial carrier protein 1.6E-15 191 279

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 15 32 17
2 65 87 22
3 102 124 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 143.23 81.08 205.38
Alive In ants, during behavior modification 180.65 100.84 260.46
Dead In ants, recently dead 137.73 78.01 197.44

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.242769 no
Alive Dead 0.101735 no
Dead Fungus 0.872738 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04258
MSVQSKPEPSPWSRATAGAAGAVLANLLAYPLDIVKTRLQVQVGQGDANSVADNEVHYTSTWNAISRIVASTNFA
YFYWYTVVRSLYLNSCPARRSSPPMSVELALGAVAGALAQLFTIPVAVVTTRQQTASRHERKSLLDTAHEVVEGP
DGILGLWRGLKASLILVVNPAITYGAYERLRTVFFHGKPNLSPWEAFLLGAFSKAIATVVTQPLIVAKVSLQSKP
PPARKGRPFRNFVEVLTFVAEREGLLALFKGIGPQIAKGLLVQGILMMTKERVEIYVLQLLSKFYATQKVCGRSL
AVEGKNSRLPNLIILFADGAKLRQHRLVEVVEE*
Coding >Ophcf2|04258
ATGAGCGTACAGTCTAAGCCAGAGCCATCTCCTTGGAGTCGCGCTACTGCCGGCGCTGCCGGTGCTGTGTTAGCA
AATCTGCTGGCGTATCCCCTGGACATTGTGAAAACGCGCCTTCAAGTCCAGGTTGGTCAAGGTGATGCCAACTCG
GTCGCGGATAATGAGGTCCATTACACTTCAACTTGGAACGCCATCTCGCGCATAGTTGCGTCCACAAATTTCGCC
TACTTTTACTGGTATACGGTGGTAAGGAGTCTGTACCTCAACTCATGCCCTGCGCGGCGTTCCTCGCCCCCAATG
AGCGTGGAACTTGCGCTCGGCGCCGTCGCAGGCGCTTTAGCACAACTTTTTACCATACCGGTGGCTGTTGTCACG
ACTCGGCAACAAACTGCAAGCCGACACGAGCGCAAAAGCCTCTTAGACACTGCTCATGAAGTAGTCGAGGGACCC
GACGGTATCTTGGGCCTCTGGAGAGGTCTCAAAGCAAGTCTCATTCTGGTTGTGAATCCTGCCATTACCTATGGC
GCATACGAGCGTCTGCGGACTGTCTTCTTCCATGGCAAACCTAATCTAAGTCCATGGGAAGCGTTCTTGCTTGGC
GCCTTTTCAAAGGCTATTGCTACGGTGGTCACACAGCCACTCATTGTAGCTAAAGTCTCGTTACAATCTAAGCCA
CCACCAGCCAGGAAAGGGAGGCCATTCCGAAATTTCGTCGAAGTATTGACCTTCGTTGCCGAGCGCGAAGGCCTT
TTGGCCCTATTCAAGGGGATCGGTCCCCAAATCGCTAAGGGCTTGTTGGTTCAGGGCATCCTTATGATGACGAAA
GAAAGAGTCGAAATTTATGTCCTGCAACTTTTGAGCAAGTTCTACGCAACTCAAAAAGTATGCGGTCGAAGCTTG
GCTGTCGAGGGCAAGAACAGTCGACTGCCAAATCTGATCATACTGTTCGCGGATGGTGCGAAGCTCAGACAGCAC
CGTCTGGTTGAGGTCGTCGAGGAATGA
Transcript >Ophcf2|04258
ATGAGCGTACAGTCTAAGCCAGAGCCATCTCCTTGGAGTCGCGCTACTGCCGGCGCTGCCGGTGCTGTGTTAGCA
AATCTGCTGGCGTATCCCCTGGACATTGTGAAAACGCGCCTTCAAGTCCAGGTTGGTCAAGGTGATGCCAACTCG
GTCGCGGATAATGAGGTCCATTACACTTCAACTTGGAACGCCATCTCGCGCATAGTTGCGTCCACAAATTTCGCC
TACTTTTACTGGTATACGGTGGTAAGGAGTCTGTACCTCAACTCATGCCCTGCGCGGCGTTCCTCGCCCCCAATG
AGCGTGGAACTTGCGCTCGGCGCCGTCGCAGGCGCTTTAGCACAACTTTTTACCATACCGGTGGCTGTTGTCACG
ACTCGGCAACAAACTGCAAGCCGACACGAGCGCAAAAGCCTCTTAGACACTGCTCATGAAGTAGTCGAGGGACCC
GACGGTATCTTGGGCCTCTGGAGAGGTCTCAAAGCAAGTCTCATTCTGGTTGTGAATCCTGCCATTACCTATGGC
GCATACGAGCGTCTGCGGACTGTCTTCTTCCATGGCAAACCTAATCTAAGTCCATGGGAAGCGTTCTTGCTTGGC
GCCTTTTCAAAGGCTATTGCTACGGTGGTCACACAGCCACTCATTGTAGCTAAAGTCTCGTTACAATCTAAGCCA
CCACCAGCCAGGAAAGGGAGGCCATTCCGAAATTTCGTCGAAGTATTGACCTTCGTTGCCGAGCGCGAAGGCCTT
TTGGCCCTATTCAAGGGGATCGGTCCCCAAATCGCTAAGGGCTTGTTGGTTCAGGGCATCCTTATGATGACGAAA
GAAAGAGTCGAAATTTATGTCCTGCAACTTTTGAGCAAGTTCTACGCAACTCAAAAAGTATGCGGTCGAAGCTTG
GCTGTCGAGGGCAAGAACAGTCGACTGCCAAATCTGATCATACTGTTCGCGGATGGTGCGAAGCTCAGACAGCAC
CGTCTGGTTGAGGTCGTCGAGGAATGA
Gene >Ophcf2|04258
ATGAGCGTACAGTCTAAGCCAGAGCCATCTCCTTGGAGTCGCGCTACTGCCGGCGCTGCCGGTGCTGTGTTAGCA
AATCTGCTGGCGTATCCCCTGGACATGTGTGTAAGGCCTCGTCCTCCGATTTTCCCCTCTTACTGCTAAATCAGA
TCACGACCTGTAAGTGTGAAAACGCGCCTTCAAGTCCAGGTTGGTCAAGGTGATGCCAACTCGGTCGCGGATAAT
GAGGTCCATTACACTTCAACTTGGAACGCCATCTCGCGCATAGTTGGTGAGGACGGCATTAGGGGCTTATATGCC
GGTATGAATGGGTCTCTGGTTGGGGTAGCGTCCACAAATTTCGCCTACTTTTACTGGTATACGGTGGTAAGGAGT
CTGTACCTCAACTCATGCCCTGCGCGGCGTTCCTCGCCCCCAATGAGCGTGGAACTTGCGCTCGGCGCCGTCGCA
GGCGCTTTAGCACAACTTTTTACCATACCGGTGGCTGTTGTCACGACTCGGCAACAAACTGCAAGCCGACACGAG
CGCAAAAGCCTCTTAGACACTGCTCATGAAGTAGTCGAGGGACCCGACGGTATCTTGGGCCTCTGGAGAGGTCTC
AAAGCAAGTCTCATTCTGGTTGTGAATCCTGCCATTACCTATGGCGCATACGAGCGTCTGCGGACTGTCTTCTTC
CATGGCAAACCTAATCTAAGTCCATGGGAAGCGTTCTGTAAGTCGACCCTTGCACCATCACAGACATATGTCTTT
TAGCTGTCCATGCGCCAAGCTGTGTCTGATGATGAGCTCCAGTGCTTGGCGCCTTTTCAAAGGCTATTGCTACGG
TGGTCACACAGCCACTCATTGTAGCTAAAGTCTCGTTACAATCTAAGCCACCACCAGCCAGGAAAGGGAGGCCAT
TCCGAAATTTCGTCGAAGTATTGACCTTCGTTGCCGAGCGCGAAGGCCTTTTGGCCCTATTCAAGGGGATCGGTC
CCCAAATCGCTAAGGGCTTGTTGGTTCAGGGCATCCTTATGATGACGAAAGAAAGGTTAGTGCAGCACGGTTTTT
TGTGACTCTGATCTACCTGCGATTTTAACGCAGCGCTTGTTGACAAACGACAGAGTCGAAATTTATGTCCTGCAA
CTTTTGAGCAAGTTCTACGCAACTCAAAAAGTATGCGGTCGAAGGTTGAGCAATATTGCCTCGTTGGTAATTATA
TATTGTCGTCTTTACTTCCGCGATCGTAAGACTTATTCTCTCTGACGCCACCGATATACTGCACACATTTATGTT
TCATGGAGCTCATATTAGAGATACTCTATTGATATGGACTACTTCTCAACCGTCTGGGATTTCGGTGAACAGAAA
ATGTTTCTTCATTGCAGCATCAACATTGCCTGCCAACAGGCTGCAGCGAGAATTATTCAGGGAGAGTTTCCTGCT
CCTCCAGCCGCTCTGGCCTGCCGAGAACCCGCCAGGAGTTTGCCACCTAGGTTAAATTTGACTAAGTCAGTATAA
TCTGTCTGGGTTAGGAAAACTCGGCCTAGTAGCGGCTCATGGAGGAAGGGCACGATGAAGCCGGTCTGGTTCGTA
CTATTGAGACAAGGCAGGGTGTTCCGGTAGAGAAGGAAGTGGCTTGCGAGAATTTGTAGCCTGTGACAAGCACAG
CGAGGAATGCAGAAGCCTCTTATCATCCTCGTGCTGCGGGTCGTAACTGTGATTGCACTCAGTAGTGGTTCCGGA
TGCAACTGGTAACCCCTCTTTGAACGGTAGAGACAGATGACGATAGTCGGAGTTGAGAGGATCATTGGACATAGA
GCCACTCGGAATCAGGCCGGTGATATTCTCCGGGGGTTGCATAGGAGTATGCCGGAGTGTAGGACGGTTTGGATG
TCGGTTGCGCGGGGGCCCATCATGACACTGCTGCTCAGAGTTGCCAAATCTGTCATTCAGGGCACTCGAGGTGCT
CTGACCCGAGAGTGATATGAGCGGCGATATAGACACCCCTCTGGAGAAGATGACGAGAAAAAGGCATGAGAGCAG
GATGACAGCTTGAAGAATGGCCATTCTCTTCTGGAAGACAACTTCTTCGGCCAATAAGTTGAGTCTGGTGCTAAG
GGCCATGATGTCCCGCTCTGAACGATCAGCTTGGCTGTCGAGGGCAAGAACAGTCGACTGCCAAATCTGATCATA
CTGTTCGCGGATGGTGCGAAGCTCAGACAGCACCGTCTGGTTGAGGTCGTCGAGGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail