Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04256
Gene name
Locationscaffold_04:1736304..1739223
Strand+
Gene length (bp)2919
Transcript length (bp)1872
Coding sequence length (bp)1872
Protein length (aa) 624

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04059 RRM_2 RNA recognition motif 2 1.9E-38 427 523

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.7871 0.7055 0.0696 0.0531 0.1165 0.0019 0.1074 0.0861 0.0492 0.0196

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4981
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7951
Ophiocordyceps australis map64 (Brazil) OphauB2|4669
Ophiocordyceps camponoti-floridani Ophcf2|04256 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4716
Ophiocordyceps kimflemingae Ophio5|8617
Ophiocordyceps subramaniannii Hirsu2|2180

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04256
MRARTVPTLLPELFISSLIASHREKETWNYSQEGCISPSGHIRATQVSFHWLDKDPFVTPSHRLGTRLSPTAIAF
NPFSALDKASYFAGEGGPIAVVLSEELGISRELHVSSTLSVSISEISTVLNQLETDGGRPHGTRCFESVDGHVLV
SFTDIRDSCSAYAGLRVSGKKWEVTYADQAPGRKGFRSSRFLNCHSGRILVTAAVLQGTTFDVLQAMDIARGLLQ
AHGQLFAFIGQSIYPNGSFKAIAEFCNVSAAAHAASNLNNFVTQEGIHFVFANHGLEIGQCVGETQLAQTSVPSI
VPGAGNSHLTRAQSPFAMYPFIVQSPFATGLPCVVDSFFPAAAQGSVNPTSSMPPSFSGVDSLYHSPPSPALTIH
KNYSPCRPIPGFSRTDARRQNAMRISRSSHHSVTGHHNHVDINRIRDGIDVRTTIMLRNIPNKVDQSMLKRIIDE
SSWGKYDFMYLRIDFANDCNVGYAFINFVDPLDIIDFVDSRGNQRWNCFKSDKVAEISYATIQGKDCLVQKFRNS
SVMLEAPHYRPKLYFTCNGPMPDLAGQEESFPDPDNQSKMKRSCENAEHVGLFTPNAGQHFRDEQRRRRSQYDRG
TRLAALEEYDYEAAMQHLYSTTK*
Coding >Ophcf2|04256
ATGCGCGCCAGAACGGTCCCTACCCTCCTACCAGAACTCTTCATCTCCTCGCTTATAGCAAGCCATCGGGAGAAG
GAAACTTGGAACTATAGTCAGGAAGGCTGCATTTCGCCCTCGGGTCACATCAGAGCAACGCAAGTTTCTTTCCAC
TGGCTGGACAAGGACCCATTCGTCACACCCTCGCATCGACTGGGTACCAGGTTATCCCCCACCGCTATAGCATTC
AATCCATTCTCCGCGTTGGACAAGGCTTCCTATTTCGCAGGTGAAGGCGGACCGATAGCGGTCGTCCTCAGCGAA
GAATTGGGCATCTCACGAGAACTTCACGTCTCTTCCACTCTTTCTGTCTCTATCTCGGAAATCAGCACTGTCCTT
AACCAACTGGAGACTGACGGAGGGCGTCCACATGGAACCCGTTGTTTCGAATCCGTCGATGGGCATGTTCTGGTC
TCATTCACGGACATTAGGGACTCATGCTCCGCATATGCTGGACTTCGCGTTTCGGGAAAAAAATGGGAGGTAACA
TACGCTGACCAGGCACCTGGTCGAAAGGGTTTTCGCTCTTCTCGTTTCTTAAATTGCCATTCTGGGCGAATTCTG
GTTACGGCGGCCGTGCTGCAGGGCACTACCTTTGATGTTTTGCAGGCCATGGACATCGCACGAGGCCTTCTGCAG
GCACATGGCCAGCTGTTCGCTTTTATAGGCCAGTCGATTTATCCGAACGGCTCATTCAAGGCCATCGCAGAGTTT
TGCAACGTGTCAGCGGCCGCTCATGCGGCATCGAACCTGAACAATTTCGTTACTCAGGAGGGAATTCATTTTGTC
TTCGCGAATCATGGCCTTGAGATCGGCCAATGCGTTGGCGAAACGCAACTAGCACAAACTTCTGTTCCATCTATT
GTTCCCGGCGCAGGAAATTCTCACCTGACGCGAGCTCAGTCCCCATTCGCCATGTACCCCTTCATTGTCCAGTCG
CCATTTGCTACTGGCTTACCTTGCGTGGTTGATTCTTTCTTTCCAGCTGCTGCGCAAGGATCGGTAAATCCAACC
TCCTCGATGCCGCCTTCGTTCTCCGGCGTTGATTCCCTTTACCACTCGCCGCCATCGCCAGCCTTGACGATTCAC
AAGAATTACAGTCCCTGCAGGCCTATCCCTGGCTTTAGCAGGACAGACGCTCGCAGGCAGAATGCTATGCGCATC
AGTCGATCATCACACCACAGTGTAACGGGTCATCACAATCACGTTGACATCAACCGAATTCGTGACGGCATTGAC
GTTCGAACTACGATAATGCTCCGAAATATACCCAACAAGGTCGACCAGTCAATGCTTAAGCGAATTATTGATGAA
TCTAGCTGGGGCAAGTATGACTTTATGTACCTCAGGATTGATTTCGCCAATGACTGCAACGTCGGCTACGCTTTC
ATAAACTTCGTCGACCCCCTAGATATCATCGATTTTGTCGACTCGCGCGGCAATCAGCGTTGGAACTGCTTCAAA
AGTGATAAAGTTGCAGAGATATCCTATGCTACCATTCAAGGTAAAGATTGTTTGGTGCAAAAATTTCGCAACAGC
TCAGTCATGCTGGAGGCACCTCATTATCGACCCAAGCTTTACTTTACTTGCAACGGTCCTATGCCTGATCTCGCA
GGTCAGGAAGAATCATTCCCGGACCCTGACAATCAGTCGAAGATGAAGAGGAGCTGCGAGAATGCTGAGCACGTC
GGTCTGTTCACCCCCAATGCCGGGCAGCACTTTCGAGACGAGCAACGCCGTAGACGATCGCAATATGACCGGGGG
ACTCGGCTGGCCGCTCTCGAAGAGTATGACTATGAAGCGGCTATGCAGCACCTTTACAGCACAACAAAATGA
Transcript >Ophcf2|04256
ATGCGCGCCAGAACGGTCCCTACCCTCCTACCAGAACTCTTCATCTCCTCGCTTATAGCAAGCCATCGGGAGAAG
GAAACTTGGAACTATAGTCAGGAAGGCTGCATTTCGCCCTCGGGTCACATCAGAGCAACGCAAGTTTCTTTCCAC
TGGCTGGACAAGGACCCATTCGTCACACCCTCGCATCGACTGGGTACCAGGTTATCCCCCACCGCTATAGCATTC
AATCCATTCTCCGCGTTGGACAAGGCTTCCTATTTCGCAGGTGAAGGCGGACCGATAGCGGTCGTCCTCAGCGAA
GAATTGGGCATCTCACGAGAACTTCACGTCTCTTCCACTCTTTCTGTCTCTATCTCGGAAATCAGCACTGTCCTT
AACCAACTGGAGACTGACGGAGGGCGTCCACATGGAACCCGTTGTTTCGAATCCGTCGATGGGCATGTTCTGGTC
TCATTCACGGACATTAGGGACTCATGCTCCGCATATGCTGGACTTCGCGTTTCGGGAAAAAAATGGGAGGTAACA
TACGCTGACCAGGCACCTGGTCGAAAGGGTTTTCGCTCTTCTCGTTTCTTAAATTGCCATTCTGGGCGAATTCTG
GTTACGGCGGCCGTGCTGCAGGGCACTACCTTTGATGTTTTGCAGGCCATGGACATCGCACGAGGCCTTCTGCAG
GCACATGGCCAGCTGTTCGCTTTTATAGGCCAGTCGATTTATCCGAACGGCTCATTCAAGGCCATCGCAGAGTTT
TGCAACGTGTCAGCGGCCGCTCATGCGGCATCGAACCTGAACAATTTCGTTACTCAGGAGGGAATTCATTTTGTC
TTCGCGAATCATGGCCTTGAGATCGGCCAATGCGTTGGCGAAACGCAACTAGCACAAACTTCTGTTCCATCTATT
GTTCCCGGCGCAGGAAATTCTCACCTGACGCGAGCTCAGTCCCCATTCGCCATGTACCCCTTCATTGTCCAGTCG
CCATTTGCTACTGGCTTACCTTGCGTGGTTGATTCTTTCTTTCCAGCTGCTGCGCAAGGATCGGTAAATCCAACC
TCCTCGATGCCGCCTTCGTTCTCCGGCGTTGATTCCCTTTACCACTCGCCGCCATCGCCAGCCTTGACGATTCAC
AAGAATTACAGTCCCTGCAGGCCTATCCCTGGCTTTAGCAGGACAGACGCTCGCAGGCAGAATGCTATGCGCATC
AGTCGATCATCACACCACAGTGTAACGGGTCATCACAATCACGTTGACATCAACCGAATTCGTGACGGCATTGAC
GTTCGAACTACGATAATGCTCCGAAATATACCCAACAAGGTCGACCAGTCAATGCTTAAGCGAATTATTGATGAA
TCTAGCTGGGGCAAGTATGACTTTATGTACCTCAGGATTGATTTCGCCAATGACTGCAACGTCGGCTACGCTTTC
ATAAACTTCGTCGACCCCCTAGATATCATCGATTTTGTCGACTCGCGCGGCAATCAGCGTTGGAACTGCTTCAAA
AGTGATAAAGTTGCAGAGATATCCTATGCTACCATTCAAGGTAAAGATTGTTTGGTGCAAAAATTTCGCAACAGC
TCAGTCATGCTGGAGGCACCTCATTATCGACCCAAGCTTTACTTTACTTGCAACGGTCCTATGCCTGATCTCGCA
GGTCAGGAAGAATCATTCCCGGACCCTGACAATCAGTCGAAGATGAAGAGGAGCTGCGAGAATGCTGAGCACGTC
GGTCTGTTCACCCCCAATGCCGGGCAGCACTTTCGAGACGAGCAACGCCGTAGACGATCGCAATATGACCGGGGG
ACTCGGCTGGCCGCTCTCGAAGAGTATGACTATGAAGCGGCTATGCAGCACCTTTACAGCACAACAAAATGA
Gene >Ophcf2|04256
ATGCGCGCCAGAACGGTCCCTACCCTCCTACCAGAACTCTTCATCTCCTCGCGTAGGTCGTTCGTGGTCCCGTCG
CCCGGCTCAACTCTCATTACACACAAGACCCCTCGTCGGATTTCTTCAGCCCTACTGAGCCCCTCCCCTTTCTCC
TCTGTTATCGATCCATCATTTTGACTCGCGGCTTACACCATTCTCTCTTCAAACGAAGTTATAGCAAGCCATCGG
GAGAAGGAAACTTGGAACTATAGTCAGGAAGGCTGCATTTCGCCCTCGGGTCACATCAGAGCAACGCAAGTTTCT
TTCCACTGGCTGGGTTAGGTATGGCGCACAGCCGCGACGTAGAGAGCCTGTCGTCGCCCAGGTCATCAAGCGGCG
GAGCGGATTCATATAAGGGAACGCCAGACACTCGCCTAACGACCTTCTCCCCGGACAACGTTTCATCTAAACATT
TCCAAAGTCTTACACGTTCTTTTTCTGCGACGTCCCCTGTCAACCTGTCTGCAAGCAGCTATGACAGCGCTGCCT
CTCTCATAGACAAGGACCCATTCGTCACACCCTCGCATCGACTGGGTACCAGGTTATCCCCCACCGCTATAGCAT
TCAATCCATTCTCCGCGTTGGACAAGGCTTCCTATTTCGCAGGTGAAGGCGGACCGATAGCGGTCGTCCTCAGCG
AAGAATTGGGCATCTCACGAGAACTTCACGTCTCTTCCACTCTTTCTGTCTCTATCTCGGAAATCAGCACTGTCC
TTAACGTTCGTGTACCTTCTATCTCGTTCCGTTTGAAATATCGAGCTCGATCTGACCTTCTTATTAGCAACTGGA
GACTGACGGAGGGCGTCCACATGGAACCCGTTGTTTCGAATCCGTCGATGGGCATGTTCTGGTCTCATTCACGGA
CATTAGGGACTCATGCTCCGCATATGCTGGACTTCGCGTTTCGGGAAAAAAATGGGAGGTAACATACGCTGACCA
GGCACCTGGTCGAAAGGTGGGAGCTTCTTTCTCCTCGATTTACACACGGGGCATGCTAATAAATCCCCCCCAAAG
GGTTTTCGCTCTTCTCGTTTCTTAAATTGCCATTCTGGGCGAATTCTGGTTACGGCGGCCGTGCTGCAGGGCACT
ACCTTTGATGTTTTGCAGGCCATGGACATCGCACGAGGCCTTCTGCAGGCACATGGCCAGCTGTTCGCTTTTATA
GGCCAGTCGATTTATCCGAACGGCTCATTCAAGGCCATCGCAGAGTTTTGCAACGTGTCAGCGGCCGCTCATGCG
GCATCGAACCTGAACAATTTCGTTACTCAGGAGGTAAGTCGGCTTCTTGGAATGTCTATTCGATCCGTCCGCTCA
TTGTTCGTCTAACTCTCCTCAGGGAATTCATTTTGTCTTCGCGAATCATGGCCTTGAGATCGGCCAATGCGTTGG
CGAAACGCAACTAGCACAAACTTCTGTTCCATCTATTGTTCCCGGCGCAGGAAATTCTCACCTGACGCGAGCTCA
GTCCCCATTCGCCATGTACCCCTTCATTGTCCAGTCGCCATTTGCTACTGGCTTACCTTGCGTGGTTGATTCTTT
CTTTCCAGCTGCTGCGCAAGGATCGGTAAATCCAACCTCCTCGATGCCGCCTTCGTTCTCCGGCGTTGATTCCCT
TTACCACTCGCCGCCATCGCCAGCCTTGACGATTCACAAGAATTACAGTCCCTGCAGGCCTATCCCTGGCTTTAG
CAGGACAGACGCTCGCAGGCAGAATGCTATGCGCATCAGTCGATCATCACACCACAGTGTAACGGGTCATCACAA
TCACGTTGACATCAACCGAATTCGTGACGGCATTGACGTTCGAACTACGGTACGTCTCACAGCTTGAACGTCATG
ATCATTGCTCTAACAATTCCAAGATAATGCTCCGAAATATACCCAACAAGGTCGACCAGTCAATGCTTAAGCGAA
TTATTGATGAATCTAGCTGGGGCAAGTATGACTTTATGTACCTCAGGATTGATTTCGCCAATGACTGCAAGTGAG
TTTCGAAGTAGACGACAGTCACTCGACTCCGATCAGGGGCTGATATTAATGCCTCGTGGCACCTAAACAGCGTCG
GCTACGCTTTCATAAACTTCGTCGACGTAAGTAAATTGCTCATTGGTCGTCTCCGAAACAGCCCGCAACTTATAC
TGACTGCAAATTAAGCCCCTAGATATCATCGATGTCTGTTATCTCCACCTACACCCGAGCTATGGAACCCAAATT
GACAATCGAGCAGTTTGTCGACTCGCGCGGCAATCAGCGTTGGTAATTGATGCCACGTCGAACTGTCTCGGCTGA
ATGCGCACTAATTGGCACAAAGGAACTGCTTCAAAAGTGATAAAGTTGCAGAGATATCCTATGCTAGTAAGTCTA
TCGTCTACGTCCTGCACGCGAGGAGCTAAGACCGCCTTTTCTCAGCCATTCAAGGTAAAGATTGTTTGGTGCAAA
AATTTCGCAACAGCTCAGTCATGCTGGAGGCACCTCATTATCGACCCAAGGTATGCCATATTCCTGCAACACCTT
CGCCAGGCGTGATGTACCGAGAAGCGTGTCTCAATGGGCTTTGCTAAGTTTGTGTAGCTTTACTTTACTTGCAAC
GGTCCTATGCCTGATCTCGCAGGTCAGGAAGAATCATTCCCGGACCCTGACAATCAGTCGAAGATGAAGAGGAGC
TGCGAGAATGCTGAGCACGTCGGCAAGTTCAACGGCCAGCTGAACTTCCGACCATTTGCTCATCCTCTCATAGGT
CTGTTCACCCCCAATGCCGGGCAGCACTTTCGAGACGAGCAACGCCGTAGACGATCGCAATATGACCGGGGGACT
CGGCTGGCCGCTCTCGAAGAGTATGACTATGAAGCGGCTATGCAGCACCTTTACAGCACAACAAAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail