Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04254
Gene name
Locationscaffold_04:1638880..1641673
Strand-
Gene length (bp)2793
Transcript length (bp)2454
Coding sequence length (bp)2454
Protein length (aa) 818

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00648 Peptidase_C2 Calpain family cysteine protease 1.2E-22 99 360
PF01067 Calpain_III Calpain large subunit, domain III 2.2E-06 556 665

GO

GO Term Description Terminal node
GO:0004198 calcium-dependent cysteine-type endopeptidase activity Yes
GO:0006508 proteolysis Yes
GO:0008233 peptidase activity No
GO:0016787 hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0003674 molecular_function No
GO:0004175 endopeptidase activity No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:0006807 nitrogen compound metabolic process No
GO:0004197 cysteine-type endopeptidase activity No
GO:0008234 cysteine-type peptidase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.6661 0.5645 0.0898 0.0497 0.1437 0.0159 0.0966 0.0512 0.3159 0.0052

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4967
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|269
Ophiocordyceps australis map64 (Brazil) OphauB2|4062
Ophiocordyceps camponoti-floridani Ophcf2|04254 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4717
Ophiocordyceps kimflemingae Ophio5|8235
Ophiocordyceps subramaniannii Hirsu2|2039

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04254
MERRAQAAEASCARTSGRVALGHAIRAAELYMEAAGETSDKAGATRLRSKCQELIALAEKLKRRQETATALTPPQ
SDILLGALRLHGNVFPPWNCDPDDDEFELNPSSQYYTDEAPFTLSATQAQNFKAWIRPAELFGLAPDRDKSQDEN
ILMQVRGHCDLVQDITTDCSVVASLSAAAKVMIGPHAVLSTILYPFDHAKGRPKLSRSGKYVIRMNFNGCPRRVV
VDDRLPASRTDRTLFVVDRRNPCLLWPALLEKAYLKVRGGYDFPGSNSGTDLWVLTGWIPEQLFLQVEDLDYDET
WARVKAAHESRDVIVTLGTGRISAEEERLMGLIGEHDYAVEDLEMPDGNTRKLLIKNPWRDAPLIVGTGGPDSGR
DNTTWITLEDVAQHFETMYLNWNPSLFTCRQDHHLTWELPPRYLATSLVKNPQYALSSASGGSIWVLVGRHFVDA
ELEIARSRHGSLAAVARQLGFMSILIFDNGGKRAHVSGSEIYRGPYVDSPQTLARLEASPGKRYTMVIDQQELPL
PNYSLTLTLFSNTPLQVKLAEERMYHNLELTGAWSRRNAGGNSSKATYYRNPQYKLVASKTTPLSILLSTDNREV
QVHVDVVWARGQRVTTVRVKDLVFSSGEYHRGCAMATIPKLEPGTYTLVCSTFDAGQTAAFAIQVSSMSPVSLDP
LPAEAAGRLRTPLATFKPVRGEGGARAPLMASWLTRASISVYDVQLPDAADGARHASSVLLRVSVVQGWGPEQVT
VATSGNGQFRKPAADLRTGDFDVEPDKVQREGMWLVIECLGSHQALWAVDGEILSDSPIQVGVWQSL*
Coding >Ophcf2|04254
ATGGAGAGGAGGGCTCAGGCCGCTGAGGCTTCATGTGCTCGAACAAGCGGCAGAGTCGCCCTTGGCCATGCCATT
CGGGCCGCTGAGCTTTACATGGAAGCTGCCGGCGAAACTTCAGACAAGGCAGGGGCCACTCGTCTGAGGAGCAAA
TGCCAGGAACTGATTGCTCTCGCCGAGAAGCTGAAGAGAAGGCAAGAGACGGCGACGGCACTGACGCCGCCCCAG
TCAGACATTCTGCTTGGCGCCCTACGCCTTCATGGAAATGTATTTCCCCCGTGGAATTGTGATCCCGACGATGAC
GAATTTGAGCTCAACCCCAGCTCGCAATACTATACAGATGAAGCACCGTTCACGCTCTCGGCAACCCAGGCGCAA
AACTTCAAAGCATGGATCAGACCGGCGGAACTCTTTGGACTTGCGCCTGACCGCGACAAAAGCCAAGATGAAAAC
ATTTTGATGCAAGTTCGTGGGCACTGCGATCTAGTCCAGGACATAACAACGGATTGCTCTGTTGTCGCCAGTCTT
TCTGCAGCTGCAAAGGTTATGATTGGGCCCCACGCGGTTCTTTCCACCATCCTATATCCTTTCGATCACGCTAAG
GGTCGTCCAAAGTTGTCACGCTCGGGAAAATATGTGATCCGCATGAACTTCAATGGCTGCCCACGGCGAGTTGTG
GTAGACGATAGGCTTCCTGCCTCCCGTACCGATCGGACCCTTTTTGTGGTGGACCGTCGGAATCCTTGTCTGCTC
TGGCCTGCTCTACTAGAGAAGGCGTATCTCAAAGTCAGGGGCGGCTATGACTTTCCGGGAAGCAATTCCGGGACT
GACTTGTGGGTTCTGACCGGTTGGATTCCTGAGCAACTTTTTCTTCAGGTCGAGGATTTAGACTACGACGAGACT
TGGGCGAGAGTCAAGGCAGCTCACGAGTCTCGCGATGTCATCGTAACCTTAGGCACGGGCCGAATATCTGCCGAG
GAAGAGCGACTGATGGGCCTCATCGGCGAGCATGATTACGCAGTGGAGGACCTTGAAATGCCTGACGGCAACACA
CGCAAGCTACTCATCAAGAATCCTTGGCGCGACGCGCCCTTGATCGTAGGAACAGGAGGTCCAGACAGTGGTCGG
GACAACACGACTTGGATAACGCTGGAGGACGTGGCTCAACACTTCGAGACCATGTACCTGAATTGGAATCCTAGC
TTGTTTACTTGTCGGCAGGATCATCATTTGACGTGGGAGTTGCCCCCAAGATATCTTGCGACCTCATTGGTCAAA
AATCCTCAATACGCTCTGTCGTCCGCTTCCGGCGGCTCGATATGGGTTCTGGTTGGTCGTCATTTTGTGGACGCT
GAGCTTGAGATAGCTCGCAGCAGACATGGCTCTCTGGCCGCAGTCGCGCGACAGCTAGGATTCATGAGCATCCTG
ATCTTCGATAACGGTGGCAAGAGAGCTCATGTGAGTGGGTCGGAAATCTATCGCGGTCCCTATGTCGATTCCCCG
CAGACACTCGCGCGTCTTGAAGCAAGTCCCGGAAAGAGGTACACAATGGTCATCGACCAGCAAGAGCTGCCTCTA
CCTAACTATTCTTTGACCTTGACACTTTTCTCCAACACACCACTGCAAGTCAAGCTAGCAGAAGAGAGAATGTAC
CACAACTTGGAGCTCACAGGAGCCTGGAGCCGACGTAACGCTGGCGGCAACTCGTCCAAGGCAACATACTACCGA
AACCCTCAATATAAGCTGGTCGCGAGCAAAACCACCCCTCTTTCTATCCTATTATCTACCGACAACCGCGAAGTT
CAAGTACACGTCGATGTCGTCTGGGCTCGCGGGCAGCGGGTAACAACTGTTCGGGTCAAAGACCTCGTCTTCTCT
TCAGGCGAGTATCATCGCGGATGCGCCATGGCAACCATTCCAAAGTTGGAGCCTGGCACCTACACTCTGGTCTGC
TCGACATTTGACGCCGGACAAACCGCCGCTTTTGCCATTCAAGTTTCGTCCATGTCGCCTGTGTCCCTTGATCCC
CTTCCAGCCGAAGCGGCTGGTAGATTGCGAACACCTCTGGCGACCTTCAAACCGGTGAGGGGCGAGGGCGGTGCT
CGTGCTCCCTTAATGGCGTCGTGGCTCACACGTGCGAGCATCTCCGTTTACGATGTGCAGCTGCCGGACGCTGCT
GACGGGGCGCGACACGCATCGTCTGTCCTGCTCCGAGTATCGGTGGTGCAAGGCTGGGGGCCGGAGCAGGTTACG
GTTGCAACTTCCGGTAATGGCCAGTTTCGGAAACCAGCGGCAGATCTACGCACCGGCGATTTCGACGTGGAGCCT
GACAAGGTGCAGAGGGAGGGTATGTGGCTCGTGATCGAATGCTTAGGATCGCACCAAGCTCTATGGGCCGTCGAT
GGCGAGATCCTCAGTGATTCGCCGATCCAAGTTGGCGTATGGCAGTCTTTGTAG
Transcript >Ophcf2|04254
ATGGAGAGGAGGGCTCAGGCCGCTGAGGCTTCATGTGCTCGAACAAGCGGCAGAGTCGCCCTTGGCCATGCCATT
CGGGCCGCTGAGCTTTACATGGAAGCTGCCGGCGAAACTTCAGACAAGGCAGGGGCCACTCGTCTGAGGAGCAAA
TGCCAGGAACTGATTGCTCTCGCCGAGAAGCTGAAGAGAAGGCAAGAGACGGCGACGGCACTGACGCCGCCCCAG
TCAGACATTCTGCTTGGCGCCCTACGCCTTCATGGAAATGTATTTCCCCCGTGGAATTGTGATCCCGACGATGAC
GAATTTGAGCTCAACCCCAGCTCGCAATACTATACAGATGAAGCACCGTTCACGCTCTCGGCAACCCAGGCGCAA
AACTTCAAAGCATGGATCAGACCGGCGGAACTCTTTGGACTTGCGCCTGACCGCGACAAAAGCCAAGATGAAAAC
ATTTTGATGCAAGTTCGTGGGCACTGCGATCTAGTCCAGGACATAACAACGGATTGCTCTGTTGTCGCCAGTCTT
TCTGCAGCTGCAAAGGTTATGATTGGGCCCCACGCGGTTCTTTCCACCATCCTATATCCTTTCGATCACGCTAAG
GGTCGTCCAAAGTTGTCACGCTCGGGAAAATATGTGATCCGCATGAACTTCAATGGCTGCCCACGGCGAGTTGTG
GTAGACGATAGGCTTCCTGCCTCCCGTACCGATCGGACCCTTTTTGTGGTGGACCGTCGGAATCCTTGTCTGCTC
TGGCCTGCTCTACTAGAGAAGGCGTATCTCAAAGTCAGGGGCGGCTATGACTTTCCGGGAAGCAATTCCGGGACT
GACTTGTGGGTTCTGACCGGTTGGATTCCTGAGCAACTTTTTCTTCAGGTCGAGGATTTAGACTACGACGAGACT
TGGGCGAGAGTCAAGGCAGCTCACGAGTCTCGCGATGTCATCGTAACCTTAGGCACGGGCCGAATATCTGCCGAG
GAAGAGCGACTGATGGGCCTCATCGGCGAGCATGATTACGCAGTGGAGGACCTTGAAATGCCTGACGGCAACACA
CGCAAGCTACTCATCAAGAATCCTTGGCGCGACGCGCCCTTGATCGTAGGAACAGGAGGTCCAGACAGTGGTCGG
GACAACACGACTTGGATAACGCTGGAGGACGTGGCTCAACACTTCGAGACCATGTACCTGAATTGGAATCCTAGC
TTGTTTACTTGTCGGCAGGATCATCATTTGACGTGGGAGTTGCCCCCAAGATATCTTGCGACCTCATTGGTCAAA
AATCCTCAATACGCTCTGTCGTCCGCTTCCGGCGGCTCGATATGGGTTCTGGTTGGTCGTCATTTTGTGGACGCT
GAGCTTGAGATAGCTCGCAGCAGACATGGCTCTCTGGCCGCAGTCGCGCGACAGCTAGGATTCATGAGCATCCTG
ATCTTCGATAACGGTGGCAAGAGAGCTCATGTGAGTGGGTCGGAAATCTATCGCGGTCCCTATGTCGATTCCCCG
CAGACACTCGCGCGTCTTGAAGCAAGTCCCGGAAAGAGGTACACAATGGTCATCGACCAGCAAGAGCTGCCTCTA
CCTAACTATTCTTTGACCTTGACACTTTTCTCCAACACACCACTGCAAGTCAAGCTAGCAGAAGAGAGAATGTAC
CACAACTTGGAGCTCACAGGAGCCTGGAGCCGACGTAACGCTGGCGGCAACTCGTCCAAGGCAACATACTACCGA
AACCCTCAATATAAGCTGGTCGCGAGCAAAACCACCCCTCTTTCTATCCTATTATCTACCGACAACCGCGAAGTT
CAAGTACACGTCGATGTCGTCTGGGCTCGCGGGCAGCGGGTAACAACTGTTCGGGTCAAAGACCTCGTCTTCTCT
TCAGGCGAGTATCATCGCGGATGCGCCATGGCAACCATTCCAAAGTTGGAGCCTGGCACCTACACTCTGGTCTGC
TCGACATTTGACGCCGGACAAACCGCCGCTTTTGCCATTCAAGTTTCGTCCATGTCGCCTGTGTCCCTTGATCCC
CTTCCAGCCGAAGCGGCTGGTAGATTGCGAACACCTCTGGCGACCTTCAAACCGGTGAGGGGCGAGGGCGGTGCT
CGTGCTCCCTTAATGGCGTCGTGGCTCACACGTGCGAGCATCTCCGTTTACGATGTGCAGCTGCCGGACGCTGCT
GACGGGGCGCGACACGCATCGTCTGTCCTGCTCCGAGTATCGGTGGTGCAAGGCTGGGGGCCGGAGCAGGTTACG
GTTGCAACTTCCGGTAATGGCCAGTTTCGGAAACCAGCGGCAGATCTACGCACCGGCGATTTCGACGTGGAGCCT
GACAAGGTGCAGAGGGAGGGTATGTGGCTCGTGATCGAATGCTTAGGATCGCACCAAGCTCTATGGGCCGTCGAT
GGCGAGATCCTCAGTGATTCGCCGATCCAAGTTGGCGTATGGCAGTCTTTGTAG
Gene >Ophcf2|04254
ATGGAGAGGAGGGCTCAGGTTCGCATCCTGTCGCGCGCAGCGGTCATCTAAGTGAACAGTCTGCTAACCCGACTA
CCTGTCAGGCCGCTGAGGCTTCATGTGCTCGAACAAGCGGCAGAGTCGCCCTTGGCCATGCCATTCGGGCCGCTG
AGCTTTACATGGAAGCTGCCGGCGAAACTTCAGACAAGGCAGGGGCCACTCGTCTGAGGAGCAAATGCCAGGAAC
TGATTGCTCTCGCCGAGAAGCTGAAGAGAAGGCAAGAGACGGCGACGGCACTGACGCCGCCCCAGTCAGACATTC
TGCTTGGCGCCCTACGCCTTCATGGAAATGTATTTCCCCCGTGGAATTGTGATCCCGACGATGACGAATTTGAGC
TCAACCCCAGCTCGCAATACTATACGTGAGTGCGAATAGTTTTACTGTCCCACGTCTAGTCTCTCTGATTACTAG
TCCTTGAAAGAGATGAAGCACCGTTCACGCTCTCGGCAACCCAGGCGCAAAACTTCAAAGCATGGATCAGACCGG
CGGAACTCTTTGGACTTGCGCCTGACCGCGACAAAAGCCAAGATGAAAACATTTTGATGCAAGTTCGTGGGCACT
GCGATCTAGTCCAGGACATAACAACGGATTGCTCTGTTGTCGCCAGTCTTTCTGCAGCTGCAAAGGTTATGATTG
GGCCCCACGCGGTATGTGCATACTATGGCATGAACGATGTGCATTGACTGGCATCCGCTGGCAAATACGATGGAA
TCATTAACGTGGTTTCCACACCAGGTTCTTTCCACCATCCTATATCCTTTCGATCACGCTAAGGGTCGTCCAAAG
TTGTCACGCTCGGGAAAATATGTGATCCGCATGAACTTCAATGGCTGCCCACGGCGAGTTGTGGTAGACGATAGG
CTTCCTGCCTCCCGTACCGATCGGACCCTTTTTGTGGTGGACCGTCGGAATCCTTGTCTGCTCTGGCCTGCTCTA
CTAGAGAAGGCGTATCTCAAAGTCAGGGGCGGCTATGACTTTCCGGGAAGCAATTCCGGGACTGACTTGTGGGTT
CTGACCGGTTGGATTCCTGAGCAACTTTTTCTTCAGGTGTAGGTCCCAGTCCTTTCATATAGCCCCTCCACTCGA
CGTCTTCTCCAGTAAGCTCGCATGCTGACTCTGTCCAAAGCGAGGATTTAGACTACGACGAGACTTGGGCGAGAG
TCAAGGCAGCTCACGAGTCTCGCGATGTCATCGTAACCTTAGGCACGGGCCGAATATCTGCCGAGGAAGAGCGAC
TGATGGGCCTCATCGGCGAGCATGATTACGCAGTGGAGGACCTTGAAATGCCTGACGGCAACACACGCAAGCTAC
TCATCAAGAATCCTTGGCGCGACGCGCCCTTGATCGTAGGAACAGGAGGTCCAGACAGTGGTCGGGACAAGTGAG
CCGCCTTCACAGCCCAACTCACGGCCTTGCTAACCCAGTGATAGCACGACTTGGATAACGCTGGAGGACGTGGCT
CAACACTTCGAGACCATGTACCTGAATTGGAATCCTAGCTTGTTTACTTGTCGGCAGGATCATCATTTGACGTGG
GAGTTGCCCCCAAGATATCTTGCGACCTCATTGGTCAAAAATCCTCAATACGCTCTGTCGTCCGCTTCCGGCGGC
TCGATATGGGTTCTGGTTGGTCGTCATTTTGTGGACGCTGAGCTTGAGATAGCTCGCAGCAGACATGGCTCTCTG
GCCGCAGTCGCGCGACAGCTAGGATTCATGAGCATCCTGATCTTCGATAACGGTGGCAAGAGAGCTCATGTGAGT
GGGTCGGAAATCTATCGCGGTCCCTATGTCGATTCCCCGCAGACACTCGCGCGTCTTGAAGCAAGTCCCGGAAAG
AGGTACACAATGGTCATCGACCAGCAAGAGCTGCCTCTACCTAACTATTCTTTGACCTTGACACTTTTCTCCAAC
ACACCACTGCAAGTCAAGCTAGCAGAAGAGAGAATGTACCACAACTTGGAGCTCACAGGAGCCTGGAGCCGACGT
AACGCTGGCGGCAACTCGTCCAAGGCAACATACTACCGAAACCCTCAATATAAGCTGGTCGCGAGCAAAACCACC
CCTCTTTCTATCCTATTATCTACCGACAACCGCGAAGTTCAAGTACACGTCGATGTCGTCTGGGCTCGCGGGCAG
CGGGTAACAACTGTTCGGGTCAAAGACCTCGTCTTCTCTTCAGGCGAGTATCATCGCGGATGCGCCATGGCAACC
ATTCCAAAGTTGGAGCCTGGCACCTACACTCTGGTCTGCTCGACATTTGACGCCGGACAAACCGCCGCTTTTGCC
ATTCAAGTTTCGTCCATGTCGCCTGTGTCCCTTGATCCCCTTCCAGCCGAAGCGGCTGGTAGATTGCGAACACCT
CTGGCGACCTTCAAACCGGTGAGGGGCGAGGGCGGTGCTCGTGCTCCCTTAATGGCGTCGTGGCTCACACGTGCG
AGCATCTCCGTTTACGATGTGCAGCTGCCGGACGCTGCTGACGGGGCGCGACACGCATCGTCTGTCCTGCTCCGA
GTATCGGTGGTGCAAGGCTGGGGGCCGGAGCAGGTTACGGTTGCAACTTCCGGTAATGGCCAGTTTCGGAAACCA
GCGGCAGATCTACGCACCGGCGATTTCGACGTGGAGCCTGACAAGGTGCAGAGGGAGGGTATGTGGCTCGTGATC
GAATGCTTAGGATCGCACCAAGCTCTATGGGCCGTCGATGGCGAGATCCTCAGTGATTCGCCGATCCAAGTTGGC
GTATGGCAGTCTTTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail