Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04245
Gene name
Locationscaffold_04:1494059..1495082
Strand+
Gene length (bp)1023
Transcript length (bp)879
Coding sequence length (bp)879
Protein length (aa) 293

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04893 Yip1 Yip1 domain 9.5E-14 94 250

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole|Golgi apparatus Signal peptide|Transmembrane domain 0.082 0.1062 0.035 0.1171 0.0912 0.0376 0.6198 0.7292 0.9068 0.0202

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 111 133 22
2 148 170 22
3 183 202 19
4 207 229 22
5 242 264 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 132.76 76.31 189.21
Alive In ants, during behavior modification 156.26 88.80 223.71
Dead In ants, recently dead 139.35 78.80 199.89

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.423888 no
Alive Dead 0.541362 no
Dead Fungus 0.838254 no

Orthologs

Orthofinder run ID4
Orthogroup5022
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5240
Ophiocordyceps australis map64 (Brazil) OphauB2|7322
Ophiocordyceps camponoti-floridani Ophcf2|04245 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4995
Ophiocordyceps kimflemingae Ophio5|2405
Ophiocordyceps subramaniannii Hirsu2|2565

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04245
MSGSGYDAVVDVDDEGDLGHTDLQEDLEFHTSNFNESTSGGSRKSRPTTSLPPPVTASTSSPSSKRFLWTLSFYA
QFFDVDTSAVLSRCWAALFPRANFLDVLEGNPDLYGPFWIATTVVLILFLGGTISQYLSTTKNTPFAYDFRLLSG
AAGLVYGYTLFLPVLLFLALRYFGSESANLLECWALYGYSNLIWIPVAIISWSPISILNWVFVAVGFSMSVAFLV
RNLYPVLSATDKQISKVLLVLVVMLHAGLSLTIKILFFAHGSPVARSPGQGGPGKSGGDGKTPAGRF*
Coding >Ophcf2|04245
ATGTCCGGTTCCGGATACGACGCAGTGGTGGACGTGGACGACGAGGGCGACCTCGGACACACGGACCTTCAGGAG
GATCTCGAGTTTCATACGTCCAACTTCAACGAGTCGACATCCGGCGGCAGCCGCAAGAGTCGACCGACGACAAGC
CTGCCCCCGCCAGTCACGGCGTCGACGTCATCCCCGTCGTCGAAGCGCTTCTTGTGGACCCTGTCCTTCTATGCG
CAATTCTTTGATGTCGACACGTCGGCGGTGTTGTCCCGGTGCTGGGCCGCGCTGTTCCCGCGGGCCAACTTTCTT
GACGTGCTCGAGGGCAATCCCGACTTGTACGGGCCGTTTTGGATCGCCACGACGGTTGTTCTCATCTTATTCTTG
GGCGGTACCATAAGCCAGTACCTCTCGACCACGAAGAATACGCCGTTTGCATACGATTTCAGGCTTTTGAGCGGC
GCTGCTGGACTCGTGTATGGATATACGCTTTTCCTTCCCGTCCTTCTGTTCCTCGCACTCCGATACTTTGGCAGC
GAGTCAGCGAATCTTCTCGAATGCTGGGCGCTATACGGCTATTCCAACCTCATCTGGATCCCGGTAGCCATCATC
AGCTGGTCGCCGATATCGATTCTCAATTGGGTCTTCGTTGCCGTCGGCTTCAGTATGTCTGTCGCTTTCCTCGTC
CGCAACCTGTACCCTGTCTTGAGCGCGACCGATAAGCAGATCAGCAAGGTGCTGCTAGTACTCGTCGTAATGCTT
CACGCCGGCCTGTCGCTTACCATCAAGATCCTATTTTTCGCTCACGGAAGCCCAGTAGCGAGGTCTCCGGGCCAG
GGTGGTCCGGGGAAATCAGGAGGGGATGGTAAGACACCTGCTGGCAGGTTTTAG
Transcript >Ophcf2|04245
ATGTCCGGTTCCGGATACGACGCAGTGGTGGACGTGGACGACGAGGGCGACCTCGGACACACGGACCTTCAGGAG
GATCTCGAGTTTCATACGTCCAACTTCAACGAGTCGACATCCGGCGGCAGCCGCAAGAGTCGACCGACGACAAGC
CTGCCCCCGCCAGTCACGGCGTCGACGTCATCCCCGTCGTCGAAGCGCTTCTTGTGGACCCTGTCCTTCTATGCG
CAATTCTTTGATGTCGACACGTCGGCGGTGTTGTCCCGGTGCTGGGCCGCGCTGTTCCCGCGGGCCAACTTTCTT
GACGTGCTCGAGGGCAATCCCGACTTGTACGGGCCGTTTTGGATCGCCACGACGGTTGTTCTCATCTTATTCTTG
GGCGGTACCATAAGCCAGTACCTCTCGACCACGAAGAATACGCCGTTTGCATACGATTTCAGGCTTTTGAGCGGC
GCTGCTGGACTCGTGTATGGATATACGCTTTTCCTTCCCGTCCTTCTGTTCCTCGCACTCCGATACTTTGGCAGC
GAGTCAGCGAATCTTCTCGAATGCTGGGCGCTATACGGCTATTCCAACCTCATCTGGATCCCGGTAGCCATCATC
AGCTGGTCGCCGATATCGATTCTCAATTGGGTCTTCGTTGCCGTCGGCTTCAGTATGTCTGTCGCTTTCCTCGTC
CGCAACCTGTACCCTGTCTTGAGCGCGACCGATAAGCAGATCAGCAAGGTGCTGCTAGTACTCGTCGTAATGCTT
CACGCCGGCCTGTCGCTTACCATCAAGATCCTATTTTTCGCTCACGGAAGCCCAGTAGCGAGGTCTCCGGGCCAG
GGTGGTCCGGGGAAATCAGGAGGGGATGGTAAGACACCTGCTGGCAGGTTTTAG
Gene >Ophcf2|04245
ATGTCCGGTTCCGGATACGACGCAGTGGTGGACGTGGACGACGAGGTAGTTGAAGAAGGCCTTTTCTTGTGCGGC
GAGGAAACCACCTTGTTGACCATATTTATGCCCCTTCCCACACGCGCAGGGCGACCTCGGACACACGGACCTTCA
GGAGGATCTCGAGTTTCATACGTCCAACTTCAACGAGTCGACATCCGGCGGCAGCCGCAAGAGTCGACCGACGAC
AAGCCTGCCCCCGCCAGTCACGGCGTCGACGTCATCCCCGTCGTCGAAGCGCTTCTTGTGGACCCTGTCCTTCTA
TGCGCAATTCTTTGATGTCGACACGTCGGCGGTGTTGTCCCGGTGCTGGGCCGCGCTGTTCCCGCGGGCCAACTT
TCTTGACGTGCTCGAGGGCAATCCCGACTTGTACGGGCCGTTTTGGATCGCCACGACGGTTGTTCTCATCTTATT
CTTGGGCGGTACCATAAGCCAGTACCTCTCGACCACGAAGAATACGCCGTTTGCATACGATTTCAGGCTTTTGAG
CGGTAAAACGCCCCTTTTGCAGTGCTTTCTACCGGCCGAGCTGACGCCCTGGTTTCCATTCTGCCAGGCGCTGCT
GGACTCGTGTATGGATATACGCTTTTCCTTCCCGTCCTTCTGTTCCTCGCACTCCGATACTTTGGCAGCGAGTCA
GCGAATCTTCTCGAATGCTGGGCGCTATACGGCTATTCCAACCTCATCTGGATCCCGGTAGCCATCATCAGCTGG
TCGCCGATATCGATTCTCAATTGGGTCTTCGTTGCCGTCGGCTTCAGTATGTCTGTCGCTTTCCTCGTCCGCAAC
CTGTACCCTGTCTTGAGCGCGACCGATAAGCAGATCAGCAAGGTGCTGCTAGTACTCGTCGTAATGCTTCACGCC
GGCCTGTCGCTTACCATCAAGATCCTATTTTTCGCTCACGGAAGCCCAGTAGCGAGGTCTCCGGGCCAGGGTGGT
CCGGGGAAATCAGGAGGGGATGGTAAGACACCTGCTGGCAGGTTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail