Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04241
Gene name
Locationscaffold_04:1364689..1365553
Strand+
Gene length (bp)864
Transcript length (bp)480
Coding sequence length (bp)480
Protein length (aa) 160

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold 1.5E-27 85 154

GO

GO Term Description Terminal node
GO:0003746 translation elongation factor activity Yes
GO:0045905 positive regulation of translational termination Yes
GO:0045901 positive regulation of translational elongation Yes
GO:0043022 ribosome binding Yes
GO:0003723 RNA binding Yes
GO:0009893 positive regulation of metabolic process No
GO:0044877 protein-containing complex binding No
GO:0031325 positive regulation of cellular metabolic process No
GO:0010608 post-transcriptional regulation of gene expression No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0034250 positive regulation of cellular amide metabolic process No
GO:0051246 regulation of protein metabolic process No
GO:0005488 binding No
GO:0031326 regulation of cellular biosynthetic process No
GO:0010604 positive regulation of macromolecule metabolic process No
GO:0048522 positive regulation of cellular process No
GO:0034248 regulation of cellular amide metabolic process No
GO:0006417 regulation of translation No
GO:1901363 heterocyclic compound binding No
GO:0043021 ribonucleoprotein complex binding No
GO:0010628 positive regulation of gene expression No
GO:0009891 positive regulation of biosynthetic process No
GO:0050789 regulation of biological process No
GO:0010557 positive regulation of macromolecule biosynthetic process No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0080090 regulation of primary metabolic process No
GO:0050794 regulation of cellular process No
GO:0045727 positive regulation of translation No
GO:0043244 regulation of protein-containing complex disassembly No
GO:0043243 positive regulation of protein-containing complex disassembly No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0051128 regulation of cellular component organization No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0008135 translation factor activity, RNA binding No
GO:0008150 biological_process No
GO:0010468 regulation of gene expression No
GO:0060255 regulation of macromolecule metabolic process No
GO:0065007 biological regulation No
GO:0031323 regulation of cellular metabolic process No
GO:0006449 regulation of translational termination No
GO:0051247 positive regulation of protein metabolic process No
GO:0019222 regulation of metabolic process No
GO:0051173 positive regulation of nitrogen compound metabolic process No
GO:0048518 positive regulation of biological process No
GO:0090079 translation regulator activity, nucleic acid binding No
GO:0045182 translation regulator activity No
GO:0051130 positive regulation of cellular component organization No
GO:0003674 molecular_function No
GO:0031328 positive regulation of cellular biosynthetic process No
GO:0006448 regulation of translational elongation No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6197 0.6599 0.062 0.1015 0.1904 0.0458 0.0312 0.0336 0.0099 0.0253

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5390
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5243
Ophiocordyceps australis map64 (Brazil) OphauB2|7325
Ophiocordyceps camponoti-floridani Ophcf2|04241 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4993
Ophiocordyceps kimflemingae Ophio5|2409
Ophiocordyceps subramaniannii Hirsu2|5532

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04241
MAEEHDVTFESADAGASLTFPMQCSALRKNGFVVIKGRPCKIVDMSTSKTGKHGHAKVHLVALDIFTGKKYEDLS
PSTHNMEVPNVSRREYQLLDISDDNFLSLMNDDGSTKDDVQVPEGELGERIMKGFKVEEKDLTIVVLTSMGEEAA
IECKEASRQ*
Coding >Ophcf2|04241
ATGGCTGAAGAGCATGATGTCACCTTTGAGTCCGCCGACGCCGGCGCGTCTCTTACTTTTCCCATGCAATGCTCG
GCTCTGCGCAAGAACGGCTTTGTCGTCATCAAGGGACGCCCCTGCAAGATTGTCGATATGTCCACGTCCAAGACC
GGAAAGCACGGCCACGCAAAGGTCCATCTCGTCGCCTTGGATATCTTTACCGGCAAGAAGTACGAGGACCTCAGT
CCCTCTACCCACAACATGGAAGTTCCAAATGTCAGTCGTCGCGAATATCAACTTCTCGATATATCCGACGACAAC
TTTCTCTCCCTCATGAATGATGACGGCTCCACCAAGGACGATGTTCAAGTTCCCGAGGGCGAGCTTGGTGAGCGG
ATCATGAAGGGCTTCAAGGTCGAAGAAAAAGATCTCACGATTGTCGTTCTCACTTCCATGGGGGAGGAAGCTGCC
ATTGAGTGCAAGGAAGCGTCCCGCCAGTGA
Transcript >Ophcf2|04241
ATGGCTGAAGAGCATGATGTCACCTTTGAGTCCGCCGACGCCGGCGCGTCTCTTACTTTTCCCATGCAATGCTCG
GCTCTGCGCAAGAACGGCTTTGTCGTCATCAAGGGACGCCCCTGCAAGATTGTCGATATGTCCACGTCCAAGACC
GGAAAGCACGGCCACGCAAAGGTCCATCTCGTCGCCTTGGATATCTTTACCGGCAAGAAGTACGAGGACCTCAGT
CCCTCTACCCACAACATGGAAGTTCCAAATGTCAGTCGTCGCGAATATCAACTTCTCGATATATCCGACGACAAC
TTTCTCTCCCTCATGAATGATGACGGCTCCACCAAGGACGATGTTCAAGTTCCCGAGGGCGAGCTTGGTGAGCGG
ATCATGAAGGGCTTCAAGGTCGAAGAAAAAGATCTCACGATTGTCGTTCTCACTTCCATGGGGGAGGAAGCTGCC
ATTGAGTGCAAGGAAGCGTCCCGCCAGTGA
Gene >Ophcf2|04241
ATGGCTGAAGAGGTGAGTCCAGCGCGCATCGGCTCTCCCTCTACACTGGGGCAGAATCCTTGTGCCAAGCGTCCC
ACTACGCAGAGCAGCTCTCCGTCGCCGCACGATGCCGCAGGCACCTTTCTCAAGGCGAGGGCATGGCGGGGAGCG
GGGGAAGAGGCGACAGACGCCGACTCGACCCAGTCAGGTGTCTTCCCGGCCGAGGCAGGCAGCTGACCATTCTGT
CTGTCCCAGCATGATGTCACCTTTGAGTCCGCCGACGCCGGCGCGTCTCTTACTTTTCCCATGCAATGCTCGGCT
CTGCGCAAGAACGGCTTTGTCGTCATCAAGGGACGCCCCTGCAAGATTGTCGATATGTCCACGTCCAAGACCGGA
AAGCACGGCCACGCAAAGGTCCATCTCGTCGCCTTGGATATCTTTACCGGCAAGAAGTACGAGGACCTCAGTCCC
TCTACCCACAACATGGAAGTTCCAAATGTCAGTCGTCGCGAATATCAACTTGTGAGTGGCATGCCTCCATACCAC
CTCTGCCAGGACCCTGGGTAGCTGGTGGCCTCATCTTATTGACTGTCCTCTCCCACCAGCTCGATATATCCGACG
ACAACTTTCTCTCCCTCATGAATGATGACGGCTCCACCAAGGACGATGTTCAAGTTCCCGAGGGCGAGCTTGGTG
AGCGGATCATGAAGGGCTTCAAGGTCGAAGAAAAAGATCTCAGTAAGCCTTGCACTCCTCTCTTTGTCCAGTGTT
GCTCTGCAGCCGGCCACAGGGTCTTGAAACTGACTGTGGATTCAAGCGATTGTCGTTCTCACTTCCATGGGGGAG
GAAGCTGCCATTGAGTGCAAGGAAGCGTCCCGCCAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail