Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04239
Gene name
Locationscaffold_04:1360358..1361736
Strand+
Gene length (bp)1378
Transcript length (bp)1146
Coding sequence length (bp)1146
Protein length (aa) 382

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 1.3E-06 156 249

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion 0.2783 0.1548 0.1955 0.1508 0.6701 0.4054 0.3347 0.2003 0.1994 0.2685

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5412
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5245
Ophiocordyceps australis map64 (Brazil) OphauB2|7327
Ophiocordyceps camponoti-floridani Ophcf2|04239 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4991
Ophiocordyceps kimflemingae Ophio5|2411
Ophiocordyceps subramaniannii Hirsu2|5709

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04239
MATDADSSPLDVTSRIKRPDVDALRVHRKMKEILDACRWRDVAALASLAESWRGLLDDDLRRTAWPILLGLPSPR
PGVGGRPEPSCVEEAPRTDWSVLPCHRDEHQVQLDVDRSFIYYPNGQTDAELAQRKAHLSSVIIEVLRPARPAEV
VARLSVLRIRDFMLPTLGPTTTQLRLLPDILAKADPEMRSHIASIEPYYALAGTLTMYAHNIEDYHDIARLFDVF
LAREPVFSIYVFAQILINRRDEILEVDESDMLQVILARVPAKMNLDDLIAKTIGIFNRYPPESLPSWREISNASV
LKTVRHVGDLADMSLEQGHAYFQQQVKEMWWSGVVDGVKLTIRRHGRPVGAVGMAIGVAATAIYLRRNPSALHRI
LSPFQT*
Coding >Ophcf2|04239
ATGGCTACAGACGCGGATAGTTCACCGCTCGATGTCACATCACGCATTAAAAGACCAGACGTCGACGCTCTTCGA
GTTCACCGGAAGATGAAAGAAATACTCGATGCCTGTCGATGGAGAGACGTGGCAGCTCTCGCGTCGCTTGCCGAG
TCATGGCGGGGTCTGCTAGACGACGATTTACGCAGAACAGCATGGCCCATCCTTCTTGGTCTACCATCTCCGCGC
CCGGGAGTCGGTGGCCGCCCGGAACCGTCCTGTGTTGAAGAAGCTCCCCGGACCGACTGGAGCGTCCTACCGTGC
CACAGAGACGAGCATCAAGTCCAGCTCGACGTCGACCGCTCTTTTATTTACTACCCGAACGGTCAGACAGATGCC
GAATTGGCCCAACGCAAGGCGCATTTATCATCCGTCATCATTGAGGTCTTGCGTCCTGCACGGCCTGCAGAGGTC
GTGGCCCGGCTATCCGTCCTCCGCATACGCGACTTCATGTTGCCCACATTAGGGCCGACGACGACTCAATTGAGG
CTGCTTCCCGACATACTAGCCAAGGCGGATCCCGAAATGCGAAGTCACATTGCCTCCATAGAGCCCTATTACGCA
TTGGCCGGCACCTTGACCATGTACGCTCACAACATTGAAGACTACCACGACATAGCGCGGCTATTCGACGTCTTT
CTTGCCCGTGAGCCTGTCTTCAGCATTTATGTGTTCGCCCAGATTCTCATAAACCGCCGTGACGAGATCCTTGAG
GTGGACGAGTCCGACATGCTTCAGGTTATCCTGGCAAGAGTTCCCGCTAAGATGAACCTCGACGACCTCATCGCC
AAAACGATTGGTATCTTCAACCGCTATCCGCCTGAGTCGCTGCCATCGTGGAGAGAAATCTCGAACGCGAGTGTC
CTGAAGACGGTTAGACACGTCGGAGACCTTGCCGACATGTCACTGGAACAAGGCCACGCTTATTTCCAGCAACAA
GTCAAGGAGATGTGGTGGTCGGGCGTTGTCGACGGCGTCAAGCTAACGATCAGGAGACATGGTCGACCAGTTGGG
GCCGTCGGGATGGCTATCGGCGTCGCCGCTACAGCAATCTACCTGCGGCGCAATCCGAGTGCGCTGCACCGCATA
TTGTCGCCATTTCAAACTTGA
Transcript >Ophcf2|04239
ATGGCTACAGACGCGGATAGTTCACCGCTCGATGTCACATCACGCATTAAAAGACCAGACGTCGACGCTCTTCGA
GTTCACCGGAAGATGAAAGAAATACTCGATGCCTGTCGATGGAGAGACGTGGCAGCTCTCGCGTCGCTTGCCGAG
TCATGGCGGGGTCTGCTAGACGACGATTTACGCAGAACAGCATGGCCCATCCTTCTTGGTCTACCATCTCCGCGC
CCGGGAGTCGGTGGCCGCCCGGAACCGTCCTGTGTTGAAGAAGCTCCCCGGACCGACTGGAGCGTCCTACCGTGC
CACAGAGACGAGCATCAAGTCCAGCTCGACGTCGACCGCTCTTTTATTTACTACCCGAACGGTCAGACAGATGCC
GAATTGGCCCAACGCAAGGCGCATTTATCATCCGTCATCATTGAGGTCTTGCGTCCTGCACGGCCTGCAGAGGTC
GTGGCCCGGCTATCCGTCCTCCGCATACGCGACTTCATGTTGCCCACATTAGGGCCGACGACGACTCAATTGAGG
CTGCTTCCCGACATACTAGCCAAGGCGGATCCCGAAATGCGAAGTCACATTGCCTCCATAGAGCCCTATTACGCA
TTGGCCGGCACCTTGACCATGTACGCTCACAACATTGAAGACTACCACGACATAGCGCGGCTATTCGACGTCTTT
CTTGCCCGTGAGCCTGTCTTCAGCATTTATGTGTTCGCCCAGATTCTCATAAACCGCCGTGACGAGATCCTTGAG
GTGGACGAGTCCGACATGCTTCAGGTTATCCTGGCAAGAGTTCCCGCTAAGATGAACCTCGACGACCTCATCGCC
AAAACGATTGGTATCTTCAACCGCTATCCGCCTGAGTCGCTGCCATCGTGGAGAGAAATCTCGAACGCGAGTGTC
CTGAAGACGGTTAGACACGTCGGAGACCTTGCCGACATGTCACTGGAACAAGGCCACGCTTATTTCCAGCAACAA
GTCAAGGAGATGTGGTGGTCGGGCGTTGTCGACGGCGTCAAGCTAACGATCAGGAGACATGGTCGACCAGTTGGG
GCCGTCGGGATGGCTATCGGCGTCGCCGCTACAGCAATCTACCTGCGGCGCAATCCGAGTGCGCTGCACCGCATA
TTGTCGCCATTTCAAACTTGA
Gene >Ophcf2|04239
ATGGCTACAGACGCGGATAGTTCACCGCTCGATGTCACATCACGCATTAAAAGACCAGACGTCGACGCTCTTCGA
GTTCACCGGAAGATGAAAGAAATACTCGATGCCTGTCGATGGAGAGACGTGGCAGCTCTCGCGTCGCTTGCCGAG
TCATGGCGGGGTCTGCTAGACGACGATTTACGCAGAACAGCATGTGCGTTTACCCTTTCCACTTGTAGTCGCCGC
GGGTCTTGTTCGCTGAAAGCTTGCTGACGCGAGGTCTTTTCGCCTCAGGGCCCATCCTTCTTGGTCTACCATCTC
CGCGCCCGGGAGTCGGTGGCCGCCCGGAACCGTCCTGTGTTGAAGAAGCTCCCCGGACCGACTGGAGCGTCCTAC
CGTGCCACAGAGACGAGCATCAAGTCCAGCTCGACGTCGACCGCTCTTTTATTTACTACCCGAACGGTACATATC
GAGGACCCTCTCCTTCCAGATCCTCCTTCCAGGATTCGGAGTCCGCCCGCTGACGCTCCCCGCTCACACCTCAGG
TCAGACAGATGCCGAATTGGCCCAACGCAAGGCGCATTTATCATCCGTCATCATTGAGGTCTTGCGTCGGCACTC
ATACCTGTGTTATTTTCAGGGTTTCCATGATATCTGCCAGGTAATCTTATTAGTCTTAGGTCCTGCACGGCCTGC
AGAGGTCGTGGCCCGGCTATCCGTCCTCCGCATACGCGACTTCATGTTGCCCACATTAGGGCCGACGACGACTCA
ATTGAGGCTGCTTCCCGACATACTAGCCAAGGCGGATCCCGAAATGCGAAGTCACATTGCCTCCATAGAGCCCTA
TTACGCATTGGCCGGCACCTTGACCATGTACGCTCACAACATTGAAGACTACCACGACATAGCGCGGCTATTCGA
CGTCTTTCTTGCCCGTGAGCCTGTCTTCAGCATTTATGTGTTCGCCCAGATTCTCATAAACCGCCGTGACGAGAT
CCTTGAGGTGGACGAGTCCGACATGCTTCAGGTTATCCTGGCAAGAGTTCCCGCTAAGATGAACCTCGACGACCT
CATCGCCAAAACGATTGGTATCTTCAACCGCTATCCGCCTGAGTCGCTGCCATCGTGGAGAGAAATCTCGAACGC
GAGTGTCCTGAAGACGGTTAGACACGTCGGAGACCTTGCCGACATGTCACTGGAACAAGGCCACGCTTATTTCCA
GCAACAAGTCAAGGAGATGTGGTGGTCGGGCGTTGTCGACGGCGTCAAGCTAACGATCAGGAGACATGGTCGACC
AGTTGGGGCCGTCGGGATGGCTATCGGCGTCGCCGCTACAGCAATCTACCTGCGGCGCAATCCGAGTGCGCTGCA
CCGCATATTGTCGCCATTTCAAACTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail