Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04236
Gene name
Locationscaffold_04:1246655..1250197
Strand+
Gene length (bp)3542
Transcript length (bp)3486
Coding sequence length (bp)3486
Protein length (aa) 1162

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03142 Chitin_synth_2 Chitin synthase 6.8E-229 413 922
PF08766 DEK_C DEK C terminal domain 6.8E-14 1106 1158
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 8.9E-11 167 235
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 5.4E-12 605 820
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 5.5E-07 588 768

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

Domain # Start End Length
1 96 118 22
2 131 153 22
3 398 420 22
4 793 815 22
5 825 847 22
6 854 876 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04236
MDTNFSASNDQLLHGRTFSHGNVSQMTLNPSPNYASSISHTGSRAASNGDYGLGTKGDTFKGDVYYNDEGEFTGT
MDTELAKNKHIQTKEVTFGRRVWVWIVWVLTFWIPSPVLRFVGRMRRPDVRMAWREKLVLCFLIFLINAIVIFWI
IAFGRLLCPNFDKAWSSKEVSSHQGKDDFWVSIHGKVYDISNFWRRQHSDTDIKTTEDNMMPLAGLKMDEYFPIP
LHLACQGLGIKETTRLLSNNTPEISSAVHTSGYYQPNPATALHKPDWYWTDFEPSIKEFYQGDLVFSQSLVESSG
KDAQHMWARYGDKIYDLTDYFHTQDIFVNLDTYKFLHPKVSDLWRNNPGQDIKRMLDDVLKDSMSNEAEHIKIEN
SWLCIKSMFYEGLTDFRETPRCTVNNWILLAFTIMVCAVVLIKFISALRFTSKRRPSPQDKFVICQVPAYTEGEE
SLRKALDSLTALQYDNKRKLICVICDGVIVGQGNDRPTPKIVLDILGVDPKVDPPALPFKSVGPGSEQLNYGKVY
SGLYEYEGNVVPYLVIVKVGKESEQTRAKPGNRGKRDSQILLMSFLNRVHHRAPMNPLELEMFHQINNIIGVDPE
LYEYLLMVDADTSVEEDSLNRLVSACAHNAKIAGICGETSLENDEKSWTTMIQVYEYFISHHLAKAFESLFGSVT
CLPGCFSMYRLRTADKGKPLIISDAVIKDYSVCDVDTLHQKNLLSLGEDRYLTTLMTKYFPYMSYKFVQDAQCKT
AAPESWSVLVSQRRRWINSTIHNLVELMRLKEMCGFCCFSMRFVVFIDLFGTIILPATCVYLGYLIYRVASRTGQ
FPLISIVMLAAVYGLQALVFILKRQWQHIGWMIIYIIAFPIYSFILPVYSFWNQDNFSWGNTRVVIGEKGNKQVV
AVDGEGFDPRSIPLQRWDDYAQANYLPGRRGGYQEKQEHGYGDQYEMDEIKSVYSAAPAGSIMTGIDGRSTAAPM
QPQMWSYMPYPSMMGMPYQDASSLLHRQSMMSMGTAMPDASASLHRQSMMSVGTAMQDARSQTPYQELPAGRQTM
TNWRSMSNLSPPAGVPAARSASALGYAGGNRPPLNADAMQSTASFDFQRGHVGADDTCIVEAIQGVLREVDLDTV
TKKQVRALVEQRLQTELVGERRTFMDRQIDRELENM*
Coding >Ophcf2|04236
ATGGACACAAACTTCAGCGCCAGCAACGACCAACTTCTTCACGGCCGCACCTTCAGTCACGGCAACGTCAGTCAG
ATGACGCTCAACCCAAGCCCGAACTATGCATCGTCCATCTCTCACACGGGCTCTCGAGCCGCCAGCAATGGGGAT
TATGGCCTCGGCACCAAGGGCGACACGTTCAAGGGGGACGTTTACTACAACGATGAAGGCGAATTCACCGGCACC
ATGGATACCGAACTCGCCAAAAACAAGCATATTCAGACCAAGGAGGTGACGTTTGGCCGCCGAGTTTGGGTTTGG
ATCGTCTGGGTTCTGACGTTTTGGATTCCCTCTCCGGTACTTCGCTTCGTCGGCAGGATGCGTCGTCCGGACGTG
CGCATGGCCTGGCGCGAGAAGCTTGTCCTCTGTTTCCTCATCTTCCTGATAAACGCCATAGTCATCTTCTGGATC
ATTGCCTTTGGAAGACTTCTCTGCCCAAACTTCGATAAGGCATGGAGCTCAAAGGAAGTAAGCTCGCACCAAGGC
AAAGACGATTTCTGGGTCAGCATTCACGGCAAAGTCTACGACATCTCCAATTTCTGGAGGCGGCAGCACAGCGAC
ACGGACATCAAGACTACGGAGGACAACATGATGCCGCTGGCTGGTCTGAAGATGGACGAGTACTTCCCCATTCCA
TTGCACCTCGCCTGCCAGGGCCTCGGCATCAAGGAGACGACCCGTCTGCTGTCAAACAACACGCCTGAGATTTCC
TCGGCCGTCCACACGTCTGGGTATTATCAGCCAAACCCGGCTACTGCCCTGCACAAGCCAGACTGGTATTGGACC
GACTTCGAGCCGTCCATCAAGGAGTTTTACCAAGGTGACCTAGTCTTCAGCCAGAGTCTGGTCGAATCGTCTGGG
AAGGATGCGCAACATATGTGGGCGAGATATGGTGACAAAATTTACGATCTGACCGACTACTTCCATACGCAAGAT
ATCTTCGTCAACTTGGATACTTACAAATTCCTGCACCCCAAGGTCAGCGACCTCTGGAGAAATAATCCTGGGCAA
GACATCAAACGAATGCTCGACGATGTACTCAAAGATTCCATGTCGAACGAGGCCGAGCACATCAAGATCGAGAAT
AGTTGGCTTTGCATCAAGAGTATGTTCTACGAGGGCTTGACGGATTTTCGCGAGACGCCGAGGTGTACCGTCAAC
AACTGGATCCTCCTAGCGTTCACTATTATGGTTTGCGCCGTCGTTCTGATCAAGTTCATCTCTGCTCTTCGATTT
ACTTCGAAGCGTCGCCCATCACCGCAAGACAAGTTCGTCATCTGCCAAGTCCCTGCCTACACCGAAGGCGAAGAA
TCGCTACGAAAGGCCTTGGACTCCCTCACAGCTCTTCAGTACGACAACAAGAGGAAGTTGATATGTGTCATTTGT
GACGGCGTCATCGTCGGCCAAGGCAACGACCGTCCAACGCCCAAGATCGTGCTAGACATTCTAGGGGTGGATCCC
AAGGTCGACCCTCCGGCCCTCCCGTTCAAGTCAGTCGGCCCCGGCAGCGAGCAGCTCAACTACGGCAAGGTGTAC
TCAGGGCTCTACGAGTACGAGGGAAATGTGGTGCCCTACCTTGTCATTGTCAAAGTCGGAAAGGAGTCGGAACAG
ACCAGAGCGAAGCCCGGCAACCGCGGAAAGCGGGACTCCCAGATTCTTCTCATGAGTTTTCTCAACCGCGTGCAC
CATAGAGCCCCTATGAATCCCCTCGAGCTCGAAATGTTTCACCAAATCAACAACATTATCGGTGTCGATCCTGAA
TTATACGAGTACCTCCTTATGGTAGACGCCGATACATCGGTCGAAGAAGACTCCCTCAACAGACTTGTGTCTGCT
TGCGCACATAACGCCAAAATTGCCGGCATTTGCGGGGAAACGAGTCTGGAAAACGACGAGAAGTCTTGGACAACG
ATGATTCAGGTGTACGAGTATTTCATCTCTCATCACCTGGCGAAGGCCTTCGAATCGTTGTTTGGCAGCGTCACT
TGTCTGCCGGGATGTTTTTCCATGTACCGACTACGGACGGCGGACAAGGGCAAGCCGCTCATCATCTCGGACGCC
GTCATCAAGGATTACAGCGTGTGCGACGTTGACACCCTCCACCAGAAGAATCTCCTGTCGCTCGGCGAGGACAGA
TATTTGACGACGCTAATGACTAAGTACTTTCCTTACATGTCATACAAGTTTGTGCAAGACGCGCAGTGCAAAACA
GCGGCACCGGAGTCTTGGAGCGTGTTGGTGTCGCAGCGGCGGCGCTGGATCAACTCTACCATTCACAACCTGGTG
GAGCTAATGCGCTTGAAGGAGATGTGTGGCTTCTGCTGCTTCAGCATGCGCTTCGTCGTCTTCATCGACCTCTTT
GGCACCATAATACTTCCCGCAACATGTGTCTATCTCGGCTATCTCATCTACCGGGTCGCCTCTCGCACGGGCCAG
TTTCCGCTCATCTCCATCGTCATGTTGGCGGCCGTATATGGTCTGCAAGCTCTGGTCTTCATTCTCAAGCGGCAA
TGGCAGCACATTGGATGGATGATAATCTACATCATCGCCTTTCCCATTTATTCTTTCATATTACCCGTGTACTCG
TTCTGGAATCAAGATAACTTCTCATGGGGCAACACGCGTGTCGTCATCGGTGAGAAGGGAAATAAGCAGGTAGTG
GCCGTTGATGGCGAAGGCTTCGATCCGCGGTCGATTCCACTGCAGCGTTGGGACGACTACGCGCAGGCCAATTAC
TTACCAGGCCGCCGCGGCGGTTACCAGGAGAAGCAAGAGCATGGATACGGCGACCAGTACGAGATGGACGAGATC
AAATCGGTCTACTCGGCCGCGCCGGCGGGCTCGATCATGACAGGCATAGACGGGCGCAGCACAGCCGCGCCTATG
CAGCCTCAGATGTGGAGCTACATGCCATACCCGTCGATGATGGGCATGCCCTACCAGGACGCGAGCTCATTATTG
CATCGCCAGTCGATGATGTCCATGGGGACAGCCATGCCAGATGCGAGCGCATCGTTGCACCGCCAGTCGATGATG
TCTGTCGGCACCGCCATGCAAGACGCGAGAAGCCAGACGCCGTACCAGGAGCTTCCGGCAGGGCGACAGACAATG
ACAAACTGGCGGAGCATGTCCAACCTTTCCCCCCCCGCAGGCGTTCCGGCGGCCCGCTCTGCTTCGGCGCTCGGC
TACGCGGGAGGCAATCGGCCGCCTTTGAACGCTGACGCGATGCAGTCGACGGCCTCGTTCGATTTCCAACGAGGT
CACGTCGGTGCGGATGACACGTGCATCGTGGAGGCCATACAGGGCGTCCTCCGTGAAGTCGACCTAGATACGGTG
ACGAAAAAGCAGGTGCGGGCGCTCGTGGAACAGCGCCTCCAGACAGAGCTGGTCGGGGAGCGACGCACCTTTATG
GATCGACAGATTGATCGCGAACTCGAGAATATGTAA
Transcript >Ophcf2|04236
ATGGACACAAACTTCAGCGCCAGCAACGACCAACTTCTTCACGGCCGCACCTTCAGTCACGGCAACGTCAGTCAG
ATGACGCTCAACCCAAGCCCGAACTATGCATCGTCCATCTCTCACACGGGCTCTCGAGCCGCCAGCAATGGGGAT
TATGGCCTCGGCACCAAGGGCGACACGTTCAAGGGGGACGTTTACTACAACGATGAAGGCGAATTCACCGGCACC
ATGGATACCGAACTCGCCAAAAACAAGCATATTCAGACCAAGGAGGTGACGTTTGGCCGCCGAGTTTGGGTTTGG
ATCGTCTGGGTTCTGACGTTTTGGATTCCCTCTCCGGTACTTCGCTTCGTCGGCAGGATGCGTCGTCCGGACGTG
CGCATGGCCTGGCGCGAGAAGCTTGTCCTCTGTTTCCTCATCTTCCTGATAAACGCCATAGTCATCTTCTGGATC
ATTGCCTTTGGAAGACTTCTCTGCCCAAACTTCGATAAGGCATGGAGCTCAAAGGAAGTAAGCTCGCACCAAGGC
AAAGACGATTTCTGGGTCAGCATTCACGGCAAAGTCTACGACATCTCCAATTTCTGGAGGCGGCAGCACAGCGAC
ACGGACATCAAGACTACGGAGGACAACATGATGCCGCTGGCTGGTCTGAAGATGGACGAGTACTTCCCCATTCCA
TTGCACCTCGCCTGCCAGGGCCTCGGCATCAAGGAGACGACCCGTCTGCTGTCAAACAACACGCCTGAGATTTCC
TCGGCCGTCCACACGTCTGGGTATTATCAGCCAAACCCGGCTACTGCCCTGCACAAGCCAGACTGGTATTGGACC
GACTTCGAGCCGTCCATCAAGGAGTTTTACCAAGGTGACCTAGTCTTCAGCCAGAGTCTGGTCGAATCGTCTGGG
AAGGATGCGCAACATATGTGGGCGAGATATGGTGACAAAATTTACGATCTGACCGACTACTTCCATACGCAAGAT
ATCTTCGTCAACTTGGATACTTACAAATTCCTGCACCCCAAGGTCAGCGACCTCTGGAGAAATAATCCTGGGCAA
GACATCAAACGAATGCTCGACGATGTACTCAAAGATTCCATGTCGAACGAGGCCGAGCACATCAAGATCGAGAAT
AGTTGGCTTTGCATCAAGAGTATGTTCTACGAGGGCTTGACGGATTTTCGCGAGACGCCGAGGTGTACCGTCAAC
AACTGGATCCTCCTAGCGTTCACTATTATGGTTTGCGCCGTCGTTCTGATCAAGTTCATCTCTGCTCTTCGATTT
ACTTCGAAGCGTCGCCCATCACCGCAAGACAAGTTCGTCATCTGCCAAGTCCCTGCCTACACCGAAGGCGAAGAA
TCGCTACGAAAGGCCTTGGACTCCCTCACAGCTCTTCAGTACGACAACAAGAGGAAGTTGATATGTGTCATTTGT
GACGGCGTCATCGTCGGCCAAGGCAACGACCGTCCAACGCCCAAGATCGTGCTAGACATTCTAGGGGTGGATCCC
AAGGTCGACCCTCCGGCCCTCCCGTTCAAGTCAGTCGGCCCCGGCAGCGAGCAGCTCAACTACGGCAAGGTGTAC
TCAGGGCTCTACGAGTACGAGGGAAATGTGGTGCCCTACCTTGTCATTGTCAAAGTCGGAAAGGAGTCGGAACAG
ACCAGAGCGAAGCCCGGCAACCGCGGAAAGCGGGACTCCCAGATTCTTCTCATGAGTTTTCTCAACCGCGTGCAC
CATAGAGCCCCTATGAATCCCCTCGAGCTCGAAATGTTTCACCAAATCAACAACATTATCGGTGTCGATCCTGAA
TTATACGAGTACCTCCTTATGGTAGACGCCGATACATCGGTCGAAGAAGACTCCCTCAACAGACTTGTGTCTGCT
TGCGCACATAACGCCAAAATTGCCGGCATTTGCGGGGAAACGAGTCTGGAAAACGACGAGAAGTCTTGGACAACG
ATGATTCAGGTGTACGAGTATTTCATCTCTCATCACCTGGCGAAGGCCTTCGAATCGTTGTTTGGCAGCGTCACT
TGTCTGCCGGGATGTTTTTCCATGTACCGACTACGGACGGCGGACAAGGGCAAGCCGCTCATCATCTCGGACGCC
GTCATCAAGGATTACAGCGTGTGCGACGTTGACACCCTCCACCAGAAGAATCTCCTGTCGCTCGGCGAGGACAGA
TATTTGACGACGCTAATGACTAAGTACTTTCCTTACATGTCATACAAGTTTGTGCAAGACGCGCAGTGCAAAACA
GCGGCACCGGAGTCTTGGAGCGTGTTGGTGTCGCAGCGGCGGCGCTGGATCAACTCTACCATTCACAACCTGGTG
GAGCTAATGCGCTTGAAGGAGATGTGTGGCTTCTGCTGCTTCAGCATGCGCTTCGTCGTCTTCATCGACCTCTTT
GGCACCATAATACTTCCCGCAACATGTGTCTATCTCGGCTATCTCATCTACCGGGTCGCCTCTCGCACGGGCCAG
TTTCCGCTCATCTCCATCGTCATGTTGGCGGCCGTATATGGTCTGCAAGCTCTGGTCTTCATTCTCAAGCGGCAA
TGGCAGCACATTGGATGGATGATAATCTACATCATCGCCTTTCCCATTTATTCTTTCATATTACCCGTGTACTCG
TTCTGGAATCAAGATAACTTCTCATGGGGCAACACGCGTGTCGTCATCGGTGAGAAGGGAAATAAGCAGGTAGTG
GCCGTTGATGGCGAAGGCTTCGATCCGCGGTCGATTCCACTGCAGCGTTGGGACGACTACGCGCAGGCCAATTAC
TTACCAGGCCGCCGCGGCGGTTACCAGGAGAAGCAAGAGCATGGATACGGCGACCAGTACGAGATGGACGAGATC
AAATCGGTCTACTCGGCCGCGCCGGCGGGCTCGATCATGACAGGCATAGACGGGCGCAGCACAGCCGCGCCTATG
CAGCCTCAGATGTGGAGCTACATGCCATACCCGTCGATGATGGGCATGCCCTACCAGGACGCGAGCTCATTATTG
CATCGCCAGTCGATGATGTCCATGGGGACAGCCATGCCAGATGCGAGCGCATCGTTGCACCGCCAGTCGATGATG
TCTGTCGGCACCGCCATGCAAGACGCGAGAAGCCAGACGCCGTACCAGGAGCTTCCGGCAGGGCGACAGACAATG
ACAAACTGGCGGAGCATGTCCAACCTTTCCCCCCCCGCAGGCGTTCCGGCGGCCCGCTCTGCTTCGGCGCTCGGC
TACGCGGGAGGCAATCGGCCGCCTTTGAACGCTGACGCGATGCAGTCGACGGCCTCGTTCGATTTCCAACGAGGT
CACGTCGGTGCGGATGACACGTGCATCGTGGAGGCCATACAGGGCGTCCTCCGTGAAGTCGACCTAGATACGGTG
ACGAAAAAGCAGGTGCGGGCGCTCGTGGAACAGCGCCTCCAGACAGAGCTGGTCGGGGAGCGACGCACCTTTATG
GATCGACAGATTGATCGCGAACTCGAGAATATGTAA
Gene >Ophcf2|04236
ATGGACACAAACTTCAGCGCCAGCAACGACCAACTTCTTCACGGCCGCACCTTCAGTCACGGCAACGTCAGTCAG
ATGACGCTCAACCCAAGCCCGAACTATGCATCGTCCATCTCTCACACGGGCTCTCGAGCCGCCAGCAATGGGGAT
TATGGCCTCGGCACCAAGGGCGACACGTTCAAGGGGGACGTTTACTACAACGATGAAGGCGAATTCACCGGCACC
ATGGATACCGAACTCGCCAAAAACAAGCATATTCAGACCAAGGAGGTGACGTTTGGCCGCCGAGTTTGGGTTTGG
ATCGTCTGGGTTCTGACGTTTTGGATTCCCTCTCCGGTACTTCGCTTCGTCGGCAGGATGCGTCGTCCGGACGTG
CGCATGGCCTGGCGCGAGAAGCTTGTCCTCTGTTTCCTCATCTTCCTGATAAACGCCATAGTCATCTTCTGGATC
ATTGCCTTTGGAAGACTTCTCTGCCCAAACTTCGATAAGGCATGGAGCTCAAAGGAAGTAAGCTCGCACCAAGGC
AAAGACGATTTCTGGGTCAGCATTCACGGCAAAGTCTACGACATCTCCAATTTCTGGAGGCGGCAGCACAGCGAC
ACGGACATCAAGACTACGGAGGACAACATGATGCCGCTGGCTGGTCTGAAGATGGACGAGTACTTCCCCATTCCA
TTGCACCTCGCCTGCCAGGGCCTCGGCATCAAGGAGACGACCCGTCTGCTGTCAAACAACACGCCTGAGATTTCC
TCGGCCGTCCACACGTCTGGGTATTATCAGCCAAACCCGGCTACTGCCCTGCACAAGCCAGACTGGTATTGGACC
GACTTCGAGCCGTCCATCAAGGAGTTTTACCAAGGTGACCTAGTCTTCAGCCAGAGTCTGGTCGAATCGTCTGGG
AAGGATGCGCAACATATGTGGGCGAGATATGGTGACAAAATTTACGATCTGACCGACTACTTCCATACGCAAGAT
ATCTTCGTCAACTTGGATACTTACAAATTCCTGCACCCCAAGGTCAGCGACCTCTGGAGAAATAATCCTGGGCAA
GACATCAAACGAATGCTCGACGATGTACTCAAAGATTCCATGTCGAACGAGGCCGAGCACATCAAGATCGAGAAT
AGTTGGCTTTGCATCAAGAGTATGTTCTACGAGGGCTTGACGGATTTTCGCGAGACGCCGAGGTGTACCGTCAAC
AACTGGATCCTCCTAGCGTTCACTATTATGGTTTGCGCCGTCGTTCTGATCAAGTTCATCTCTGCTCTTCGATTT
ACTTCGAAGCGTCGCCCATCACCGCAAGACAAGTTCGTCATCTGCCAAGTCCCTGCCTACACCGAAGGCGAAGAA
TCGCTACGAAAGGCCTTGGACTCCCTCACAGCTCTTCAGTACGACAACAAGAGGAAGTTGATATGTGTCATTTGT
GACGGCGTCATCGTCGGCCAAGGCAACGACCGTCCAACGCCCAAGATCGTGCTAGACATTCTAGGGGTGGATCCC
AAGGTCGACCCTCCGGCCCTCCCGTTCAAGTCAGTCGGCCCCGGCAGCGAGCAGCTCAACTACGGCAAGGTGTAC
TCAGGGCTCTACGAGTACGAGGGAAATGTGGTGCCCTACCTTGTCATTGTCAAAGTCGGAAAGGAGTCGGAACAG
ACCAGAGCGAAGCCCGGCAACCGCGGAAAGCGGGACTCCCAGATTCTTCTCATGAGTTTTCTCAACCGCGTGCAC
CATAGAGCCCCTATGAATCCCCTCGAGCTCGAAATGTTTCACCAAATCAACAACATTATCGGTGTCGATCCTGAA
TTATACGAGTACCTCCTTATGGTAGACGCCGATACATCGGTCGAAGAAGACTCCCTCAACAGACTTGTGTCTGCT
TGCGCACATAACGCCAAAATTGCCGGCATTTGCGGGGAAACGAGTCTGGAAAACGACGAGAAGTCTTGGACAACG
ATGATTCAGGTGTACGAGTATTTCATCTCTCATCACCTGGCGAAGGCCTTCGAATCGTTGTTTGGCAGCGTCACT
TGTCTGCCGGGATGGTGAGTCTTGACGAATGGCTCTGATGGCTGGTGCCTCGCTGATCTGCTGCGCAAAGTTTTT
CCATGTACCGACTACGGACGGCGGACAAGGGCAAGCCGCTCATCATCTCGGACGCCGTCATCAAGGATTACAGCG
TGTGCGACGTTGACACCCTCCACCAGAAGAATCTCCTGTCGCTCGGCGAGGACAGATATTTGACGACGCTAATGA
CTAAGTACTTTCCTTACATGTCATACAAGTTTGTGCAAGACGCGCAGTGCAAAACAGCGGCACCGGAGTCTTGGA
GCGTGTTGGTGTCGCAGCGGCGGCGCTGGATCAACTCTACCATTCACAACCTGGTGGAGCTAATGCGCTTGAAGG
AGATGTGTGGCTTCTGCTGCTTCAGCATGCGCTTCGTCGTCTTCATCGACCTCTTTGGCACCATAATACTTCCCG
CAACATGTGTCTATCTCGGCTATCTCATCTACCGGGTCGCCTCTCGCACGGGCCAGTTTCCGCTCATCTCCATCG
TCATGTTGGCGGCCGTATATGGTCTGCAAGCTCTGGTCTTCATTCTCAAGCGGCAATGGCAGCACATTGGATGGA
TGATAATCTACATCATCGCCTTTCCCATTTATTCTTTCATATTACCCGTGTACTCGTTCTGGAATCAAGATAACT
TCTCATGGGGCAACACGCGTGTCGTCATCGGTGAGAAGGGAAATAAGCAGGTAGTGGCCGTTGATGGCGAAGGCT
TCGATCCGCGGTCGATTCCACTGCAGCGTTGGGACGACTACGCGCAGGCCAATTACTTACCAGGCCGCCGCGGCG
GTTACCAGGAGAAGCAAGAGCATGGATACGGCGACCAGTACGAGATGGACGAGATCAAATCGGTCTACTCGGCCG
CGCCGGCGGGCTCGATCATGACAGGCATAGACGGGCGCAGCACAGCCGCGCCTATGCAGCCTCAGATGTGGAGCT
ACATGCCATACCCGTCGATGATGGGCATGCCCTACCAGGACGCGAGCTCATTATTGCATCGCCAGTCGATGATGT
CCATGGGGACAGCCATGCCAGATGCGAGCGCATCGTTGCACCGCCAGTCGATGATGTCTGTCGGCACCGCCATGC
AAGACGCGAGAAGCCAGACGCCGTACCAGGAGCTTCCGGCAGGGCGACAGACAATGACAAACTGGCGGAGCATGT
CCAACCTTTCCCCCCCCGCAGGCGTTCCGGCGGCCCGCTCTGCTTCGGCGCTCGGCTACGCGGGAGGCAATCGGC
CGCCTTTGAACGCTGACGCGATGCAGTCGACGGCCTCGTTCGATTTCCAACGAGGTCACGTCGGTGCGGATGACA
CGTGCATCGTGGAGGCCATACAGGGCGTCCTCCGTGAAGTCGACCTAGATACGGTGACGAAAAAGCAGGTGCGGG
CGCTCGTGGAACAGCGCCTCCAGACAGAGCTGGTCGGGGAGCGACGCACCTTTATGGATCGACAGATTGATCGCG
AACTCGAGAATATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail