Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04235
Gene name
Locationscaffold_04:1238411..1244104
Strand-
Gene length (bp)5693
Transcript length (bp)5571
Coding sequence length (bp)5571
Protein length (aa) 1857

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03142 Chitin_synth_2 Chitin synthase 5.3E-250 1200 1707
PF00063 Myosin_head Myosin head (motor domain) 8.7E-72 84 756
PF08766 DEK_C DEK C terminal domain 6.1E-15 1799 1852
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 3.1E-08 945 1010
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 2.9E-11 1392 1605

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0003774 cytoskeletal motor activity Yes
GO:0016459 myosin complex Yes
GO:0017076 purine nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0032991 protein-containing complex No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0030554 adenyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0035639 purine ribonucleoside triphosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 877 896 19
2 917 936 19
3 1579 1601 22
4 1608 1630 22
5 1640 1662 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04235
MASTLPPLATGNGGAHTQHSLPSLPAHLQSDTHITGHLASRFHASHPTATLSSHGLVCLNTYTSSARGPDGGKAG
SAMAGAEDMAHHAWMRLGRRSESQAVVFLGESGSGKSTVRNHMLSALLDKSSSPLSTKLSLAAYVFDTLTTTKTA
TTPTASKSGLFYELQYDTTSTTHPTLIGGKVLDHRLERSRITDVPSGERNFHILYYLLAGTSEAEKTHLGLDGAK
RWKYLGHPTQLKVGINDAEGFQLFKSALKKLEFPRGEIAEICQILATILHIGQLEFESTSNTSATGDESGGFSHD
GGITSTTVKNKDVLGIIAAFLGVSTGDLQSTLGYKTKTIQKERVTVLLDPNGARAHANELARTLYSLLVAWIIEN
ANQRICALDDGVANTISLVDFPGFAQQPSTSSTMDQLLNNAATEAIYNLALHNFFDRKADMLESEEVTVAPTSYF
DNSDAVKGLLKPGNGLLSILDDQTRRNRTDMQLLESFRKRFEGKNPAIEVSSSTAKLPGSNFLTENTAASFTVKH
FAGEVNYPVKGLVEENGEVISVDLLNMFNATKSEFIGRLFGQDALQTIAHPGEKTSVLQASVSSKPMRAPSVMTR
SGTRPKGSIPRRHLESLDPKDQKGEGIEKQGNAKGSSELGASGQFLSSLDNVQKAVTDPGTNSYFVFCLKTNDRR
IANQFDSKCVRTQVQTFGIAEISQRLRSADFSIFLPFGEFLGMADAETILVGSERERVEMIIDEKVWPRNEVQVG
STGVFLSERCWMEVAHFSDEKAAGRFGMGGEGGEAGEGPAFTEQLGFTASKEQLLSSGNTPLMYAEKAKAGYFTG
SDDTRSEAGVSALGAGDMFKNLDTREQMAERGNEKSLEEVEEFKDSPSRKRWVFTVYFLTWFVPDFLIRWMGRMP
RKDVRMAWREKVAINMLIWLLCLIAAFFIVVFPALICPKQNVYSAQELSEYDGEPNSKGAYVSIRGYVVDLGAYV
SHHYPPYLDKKALTKYAGKDVSSLFPVQVSALCHGVSGSVNDEVTLDYKNTNITESPTLVNLQDVNAKYHDFRHF
TNDSRPDWYQEQLVKLRGTWGKGNIGYSAEYVSTLAQKQQTIAIIGHRVYDLTTYLHGGRKMRAKAGEKPPNDPS
LADFMDVEVLQLFQSKAGTDITKFWHLLDITPEVRARMQTCLDYLFYVGDVDTRRSARCQFAEYLVLSVSCLLAS
VIAFKFFAALQFGGKNVPENLDKFVMCQIPAYTEDEDSLRRAIDSAARMRYDDKRKLLVVVCDGMIVGQGNDRPT
PRIVLDILGVSESVDPEPLSFESLGEGQKQHNMGRVYSGLYEVQGHIVPFLVIVKVGKPSEVVRPGNRGKRDSQM
VIMRFLNRVHYNLPMSPLELEMYHQIRNIIGVNPTFYEFMLQIDADTVVAPDSATRMVSAFLDDTLLIAVCGETA
LTNAKSSFITMIQVYEYYISHNLSKAFESLFGSVTCLPGCFSMYRIRAAETGKPLFVSREVVEAYATIRVDTLHM
KNLLHLGEDRYLTTLLLKYHSKYKTKYIFTAHAWTIAPDSWQVFLSQRRRWINSTVHNLIELIPMNQLCGFCCFS
MRFIVFIDLLSTVVQPVTIAYIIYLVTLVATRATLVPITAFVLLGAIYGLQAIIFILRRKWEMVGWMILYVLAVP
VFSFGLPLYAFWHMDDFNWGNTRVVAGEKGKKVVISDEGKFDPSSIPRKKWEEYQAELWETQTSREDARSEISAF
SYGTKAQPLVSEYAFPSRPGSTTGFAGHPSMTHIPYDSRNVSRMSLVASESPGNRMSHFSGTQYFNPDDMVGLPS
DDALLAEIRDILRTADLMTVTKKGVKQELERRFDVPLDIKRAYINSATEAILSGQL*
Coding >Ophcf2|04235
ATGGCCTCGACTCTTCCTCCCCTGGCCACGGGCAATGGAGGAGCTCACACCCAACATTCTCTGCCGTCACTGCCG
GCTCATCTCCAATCGGACACGCACATCACCGGCCATCTGGCCAGTCGCTTCCACGCGTCTCATCCCACCGCCACC
CTTTCCTCCCATGGCCTTGTCTGCCTCAACACATACACCTCCTCCGCCAGGGGGCCTGATGGCGGCAAGGCCGGC
AGCGCCATGGCCGGTGCCGAAGACATGGCCCACCACGCCTGGATGAGGCTCGGTCGCCGCTCAGAGAGCCAGGCC
GTCGTCTTCCTTGGCGAGTCGGGATCGGGAAAGTCGACCGTCCGTAATCATATGCTCTCGGCACTGCTTGACAAG
TCTTCCTCGCCTTTGTCGACCAAGCTCTCACTGGCTGCCTATGTCTTCGACACTCTCACCACGACCAAGACGGCC
ACCACGCCCACGGCCTCAAAGTCTGGTCTGTTCTACGAATTGCAATACGACACTACCAGCACCACCCACCCGACC
TTAATTGGTGGCAAAGTCCTGGATCACAGGCTGGAGAGGAGTCGGATCACCGACGTGCCCTCGGGCGAGCGTAAC
TTCCACATCCTCTACTATCTCCTGGCCGGCACTAGCGAGGCCGAGAAGACACATCTAGGGCTCGATGGCGCCAAG
AGATGGAAGTACCTCGGGCACCCGACTCAGCTCAAGGTCGGCATCAACGACGCCGAAGGCTTCCAGCTCTTCAAA
AGCGCCCTTAAGAAGCTCGAATTTCCGAGGGGCGAGATTGCTGAGATTTGTCAAATCTTAGCCACCATCCTCCAC
ATCGGCCAGCTCGAGTTCGAGTCGACCAGCAACACCAGCGCCACTGGCGATGAGAGCGGCGGCTTCTCACACGAT
GGCGGCATCACTTCCACCACGGTCAAGAATAAGGATGTCCTCGGCATCATCGCCGCTTTCCTCGGTGTCAGCACC
GGCGACCTCCAAAGCACTCTCGGCTATAAGACCAAGACGATACAGAAGGAGCGCGTGACCGTTTTGCTCGATCCC
AACGGCGCCCGCGCTCATGCCAACGAGCTTGCTCGCACTTTGTATTCCCTGTTAGTAGCCTGGATCATCGAAAAC
GCTAATCAGAGGATCTGCGCCCTGGACGACGGCGTCGCCAACACCATATCTCTCGTCGACTTCCCCGGCTTCGCC
CAACAGCCGTCCACCAGCTCAACGATGGACCAGCTCCTGAATAACGCCGCCACTGAAGCCATCTACAACCTGGCG
CTTCACAACTTTTTCGACCGCAAGGCGGATATGCTCGAGTCGGAGGAAGTAACAGTCGCCCCGACCAGCTACTTT
GACAATTCCGACGCTGTCAAGGGTCTGCTCAAGCCTGGAAATGGTCTCTTGAGCATCCTTGATGATCAGACGAGG
CGCAATAGGACCGACATGCAGCTCCTGGAAAGTTTTCGAAAACGTTTCGAAGGCAAAAACCCGGCTATCGAGGTC
AGCTCGTCCACGGCGAAGCTCCCTGGCAGCAACTTTTTGACAGAGAACACGGCCGCTTCATTCACCGTCAAGCAC
TTCGCCGGCGAGGTCAACTACCCCGTCAAGGGCCTGGTCGAGGAAAACGGCGAAGTCATTTCGGTCGATCTGCTC
AATATGTTCAACGCGACCAAGAGCGAGTTCATTGGCAGGCTATTCGGACAGGACGCCCTGCAGACTATAGCCCAT
CCTGGTGAAAAGACTTCTGTTCTTCAGGCGTCCGTCAGTTCCAAGCCGATGCGGGCCCCAAGCGTCATGACGCGA
TCGGGCACACGCCCAAAGGGCTCGATTCCTCGACGACATCTGGAGTCGTTGGATCCGAAGGATCAGAAGGGGGAA
GGCATCGAGAAGCAAGGCAATGCCAAGGGCTCGTCCGAACTGGGAGCCTCGGGCCAATTTCTGTCGTCTCTCGAC
AATGTGCAGAAGGCCGTTACGGACCCAGGCACCAATTCCTACTTCGTCTTCTGCCTGAAGACAAATGATCGCCGC
ATTGCGAACCAATTCGATAGTAAATGCGTACGAACCCAGGTGCAGACGTTTGGCATCGCCGAGATCAGTCAGAGA
CTGCGCTCGGCTGACTTCAGTATCTTCCTCCCTTTCGGCGAGTTTCTTGGAATGGCTGATGCCGAGACGATTCTT
GTCGGCAGCGAGCGCGAACGGGTCGAAATGATTATCGACGAGAAGGTATGGCCCAGAAACGAGGTGCAAGTCGGC
TCTACCGGCGTCTTTCTGAGCGAGAGGTGTTGGATGGAAGTCGCCCACTTTTCGGATGAGAAGGCAGCCGGACGC
TTCGGCATGGGAGGCGAGGGTGGTGAAGCCGGGGAGGGGCCCGCTTTCACTGAGCAGCTCGGGTTCACCGCCTCA
AAGGAGCAGCTTCTGTCGTCCGGCAACACACCTTTGATGTACGCGGAGAAGGCCAAAGCCGGCTACTTCACCGGC
TCGGATGACACTCGGTCCGAAGCAGGCGTTTCGGCACTTGGGGCTGGCGATATGTTCAAGAATCTCGACACGCGA
GAGCAAATGGCTGAGCGAGGCAACGAGAAGTCGCTTGAGGAGGTGGAGGAGTTCAAAGACAGCCCAAGCCGCAAG
CGTTGGGTTTTTACCGTCTATTTCTTAACTTGGTTTGTGCCCGACTTTCTCATCAGATGGATGGGACGCATGCCG
CGTAAAGATGTCCGCATGGCGTGGAGGGAAAAGGTGGCCATCAACATGCTCATCTGGCTTCTATGCTTGATTGCC
GCCTTCTTCATCGTCGTCTTTCCCGCACTCATCTGCCCGAAGCAAAATGTCTACAGCGCCCAGGAGCTCTCGGAA
TACGATGGCGAGCCGAACAGCAAAGGGGCTTACGTGTCTATTCGTGGCTACGTCGTTGATCTCGGTGCCTACGTC
TCCCATCATTACCCGCCCTATCTAGACAAAAAAGCTCTTACGAAGTACGCCGGCAAGGATGTCAGCTCTCTCTTC
CCTGTCCAAGTCTCGGCTTTGTGCCATGGAGTTAGCGGCTCCGTCAACGACGAGGTCACGCTCGACTACAAGAAC
ACCAACATAACAGAATCCCCGACCCTCGTCAACTTGCAGGACGTCAACGCAAAGTATCACGATTTCCGGCACTTT
ACGAACGACTCGAGGCCAGACTGGTATCAAGAACAGCTGGTGAAACTCCGAGGGACCTGGGGCAAGGGAAATATT
GGTTACTCGGCGGAATACGTCAGCACTCTGGCTCAGAAGCAACAGACGATCGCCATCATCGGACACCGGGTTTAC
GATCTGACCACCTATCTTCATGGCGGACGCAAGATGCGGGCCAAGGCCGGCGAGAAGCCGCCCAACGACCCTTCG
CTGGCGGACTTCATGGATGTCGAAGTACTGCAGTTGTTCCAGAGCAAGGCCGGAACCGATATCACTAAGTTCTGG
CACTTGCTGGACATCACGCCGGAGGTCAGGGCCAGGATGCAGACCTGCCTCGACTACCTGTTCTACGTTGGCGAT
GTCGACACGAGAAGGTCGGCTAGGTGCCAGTTCGCCGAGTACCTAGTTCTGTCGGTCTCGTGCCTCCTGGCATCG
GTCATCGCCTTCAAATTCTTCGCGGCGCTTCAGTTCGGCGGCAAGAATGTGCCGGAAAACCTGGACAAGTTCGTC
ATGTGCCAGATTCCGGCCTACACTGAGGACGAGGACTCGCTACGGCGCGCCATCGACTCTGCGGCCCGCATGCGT
TACGACGACAAGCGTAAGCTCCTAGTCGTTGTGTGCGATGGCATGATCGTTGGCCAAGGCAACGACAGGCCGACG
CCGCGCATCGTGCTCGACATCCTCGGCGTCTCAGAGTCCGTCGACCCCGAACCGCTCAGCTTCGAGTCGCTTGGT
GAAGGTCAAAAGCAGCACAACATGGGCAGGGTCTACTCAGGCCTCTACGAGGTTCAGGGCCACATTGTGCCGTTC
CTGGTTATCGTCAAGGTCGGGAAGCCGTCCGAGGTCGTGCGTCCCGGGAATCGTGGCAAGCGGGACTCGCAGATG
GTCATCATGCGCTTCCTGAACCGCGTACACTACAACCTACCCATGAGTCCGTTGGAACTTGAGATGTATCACCAG
ATCCGCAACATCATCGGCGTAAACCCGACCTTTTACGAATTTATGCTGCAGATTGACGCCGATACCGTCGTGGCG
CCCGACTCGGCGACTCGCATGGTGTCTGCGTTTCTCGACGATACGCTCCTGATTGCTGTCTGTGGCGAGACGGCG
CTGACCAATGCCAAGTCGTCCTTCATCACCATGATCCAGGTGTATGAGTACTACATCTCGCACAACTTGTCCAAG
GCCTTTGAGAGTCTCTTCGGCTCCGTCACCTGCCTGCCCGGCTGCTTCTCCATGTACCGCATCCGCGCGGCTGAG
ACTGGCAAGCCGCTGTTCGTCAGCCGCGAGGTTGTCGAAGCCTACGCCACGATCCGCGTCGATACGCTGCACATG
AAGAACCTACTGCACCTGGGTGAAGATCGCTATCTGACGACGCTGCTACTAAAATATCACTCCAAGTACAAGACG
AAATACATCTTTACGGCTCATGCGTGGACCATCGCCCCCGATTCTTGGCAGGTCTTTCTCTCGCAGCGTCGGCGA
TGGATCAACTCGACCGTCCACAACCTCATTGAGCTTATCCCGATGAACCAGCTCTGCGGCTTCTGTTGCTTCAGC
ATGCGCTTCATCGTCTTCATCGACTTGTTGAGCACCGTCGTCCAGCCGGTAACGATTGCCTATATAATCTACCTG
GTGACACTAGTGGCGACGAGGGCGACGCTTGTGCCCATCACCGCCTTTGTCCTGCTCGGCGCCATCTACGGTCTG
CAAGCTATTATCTTCATCCTGCGCCGCAAGTGGGAGATGGTCGGCTGGATGATTCTCTACGTCCTCGCCGTACCT
GTCTTCAGTTTTGGTCTGCCGCTCTACGCCTTCTGGCACATGGACGATTTCAACTGGGGCAATACACGTGTCGTT
GCGGGCGAAAAGGGCAAAAAGGTCGTCATCTCGGACGAGGGCAAATTCGATCCCAGCTCCATTCCGCGCAAGAAG
TGGGAGGAGTACCAGGCAGAGCTCTGGGAGACGCAGACGTCGCGCGAAGACGCCAGGTCTGAGATCTCGGCCTTC
AGCTATGGCACCAAGGCCCAGCCGCTGGTGTCCGAGTACGCGTTCCCCAGCCGGCCGGGGTCGACGACGGGCTTC
GCCGGCCATCCATCGATGACTCACATTCCCTACGACTCACGCAACGTGTCGCGCATGTCCTTGGTCGCGTCTGAG
TCCCCCGGCAACCGTATGAGCCACTTCAGCGGCACCCAGTACTTCAACCCGGATGACATGGTCGGCCTGCCCAGC
GACGATGCACTCTTGGCCGAGATACGCGACATTTTGCGGACGGCCGATCTAATGACGGTGACGAAGAAGGGCGTC
AAGCAAGAGCTAGAGCGTCGATTCGATGTGCCGCTAGATATCAAGCGAGCCTATATCAACAGCGCGACCGAGGCT
ATCCTATCCGGCCAGCTTTAA
Transcript >Ophcf2|04235
ATGGCCTCGACTCTTCCTCCCCTGGCCACGGGCAATGGAGGAGCTCACACCCAACATTCTCTGCCGTCACTGCCG
GCTCATCTCCAATCGGACACGCACATCACCGGCCATCTGGCCAGTCGCTTCCACGCGTCTCATCCCACCGCCACC
CTTTCCTCCCATGGCCTTGTCTGCCTCAACACATACACCTCCTCCGCCAGGGGGCCTGATGGCGGCAAGGCCGGC
AGCGCCATGGCCGGTGCCGAAGACATGGCCCACCACGCCTGGATGAGGCTCGGTCGCCGCTCAGAGAGCCAGGCC
GTCGTCTTCCTTGGCGAGTCGGGATCGGGAAAGTCGACCGTCCGTAATCATATGCTCTCGGCACTGCTTGACAAG
TCTTCCTCGCCTTTGTCGACCAAGCTCTCACTGGCTGCCTATGTCTTCGACACTCTCACCACGACCAAGACGGCC
ACCACGCCCACGGCCTCAAAGTCTGGTCTGTTCTACGAATTGCAATACGACACTACCAGCACCACCCACCCGACC
TTAATTGGTGGCAAAGTCCTGGATCACAGGCTGGAGAGGAGTCGGATCACCGACGTGCCCTCGGGCGAGCGTAAC
TTCCACATCCTCTACTATCTCCTGGCCGGCACTAGCGAGGCCGAGAAGACACATCTAGGGCTCGATGGCGCCAAG
AGATGGAAGTACCTCGGGCACCCGACTCAGCTCAAGGTCGGCATCAACGACGCCGAAGGCTTCCAGCTCTTCAAA
AGCGCCCTTAAGAAGCTCGAATTTCCGAGGGGCGAGATTGCTGAGATTTGTCAAATCTTAGCCACCATCCTCCAC
ATCGGCCAGCTCGAGTTCGAGTCGACCAGCAACACCAGCGCCACTGGCGATGAGAGCGGCGGCTTCTCACACGAT
GGCGGCATCACTTCCACCACGGTCAAGAATAAGGATGTCCTCGGCATCATCGCCGCTTTCCTCGGTGTCAGCACC
GGCGACCTCCAAAGCACTCTCGGCTATAAGACCAAGACGATACAGAAGGAGCGCGTGACCGTTTTGCTCGATCCC
AACGGCGCCCGCGCTCATGCCAACGAGCTTGCTCGCACTTTGTATTCCCTGTTAGTAGCCTGGATCATCGAAAAC
GCTAATCAGAGGATCTGCGCCCTGGACGACGGCGTCGCCAACACCATATCTCTCGTCGACTTCCCCGGCTTCGCC
CAACAGCCGTCCACCAGCTCAACGATGGACCAGCTCCTGAATAACGCCGCCACTGAAGCCATCTACAACCTGGCG
CTTCACAACTTTTTCGACCGCAAGGCGGATATGCTCGAGTCGGAGGAAGTAACAGTCGCCCCGACCAGCTACTTT
GACAATTCCGACGCTGTCAAGGGTCTGCTCAAGCCTGGAAATGGTCTCTTGAGCATCCTTGATGATCAGACGAGG
CGCAATAGGACCGACATGCAGCTCCTGGAAAGTTTTCGAAAACGTTTCGAAGGCAAAAACCCGGCTATCGAGGTC
AGCTCGTCCACGGCGAAGCTCCCTGGCAGCAACTTTTTGACAGAGAACACGGCCGCTTCATTCACCGTCAAGCAC
TTCGCCGGCGAGGTCAACTACCCCGTCAAGGGCCTGGTCGAGGAAAACGGCGAAGTCATTTCGGTCGATCTGCTC
AATATGTTCAACGCGACCAAGAGCGAGTTCATTGGCAGGCTATTCGGACAGGACGCCCTGCAGACTATAGCCCAT
CCTGGTGAAAAGACTTCTGTTCTTCAGGCGTCCGTCAGTTCCAAGCCGATGCGGGCCCCAAGCGTCATGACGCGA
TCGGGCACACGCCCAAAGGGCTCGATTCCTCGACGACATCTGGAGTCGTTGGATCCGAAGGATCAGAAGGGGGAA
GGCATCGAGAAGCAAGGCAATGCCAAGGGCTCGTCCGAACTGGGAGCCTCGGGCCAATTTCTGTCGTCTCTCGAC
AATGTGCAGAAGGCCGTTACGGACCCAGGCACCAATTCCTACTTCGTCTTCTGCCTGAAGACAAATGATCGCCGC
ATTGCGAACCAATTCGATAGTAAATGCGTACGAACCCAGGTGCAGACGTTTGGCATCGCCGAGATCAGTCAGAGA
CTGCGCTCGGCTGACTTCAGTATCTTCCTCCCTTTCGGCGAGTTTCTTGGAATGGCTGATGCCGAGACGATTCTT
GTCGGCAGCGAGCGCGAACGGGTCGAAATGATTATCGACGAGAAGGTATGGCCCAGAAACGAGGTGCAAGTCGGC
TCTACCGGCGTCTTTCTGAGCGAGAGGTGTTGGATGGAAGTCGCCCACTTTTCGGATGAGAAGGCAGCCGGACGC
TTCGGCATGGGAGGCGAGGGTGGTGAAGCCGGGGAGGGGCCCGCTTTCACTGAGCAGCTCGGGTTCACCGCCTCA
AAGGAGCAGCTTCTGTCGTCCGGCAACACACCTTTGATGTACGCGGAGAAGGCCAAAGCCGGCTACTTCACCGGC
TCGGATGACACTCGGTCCGAAGCAGGCGTTTCGGCACTTGGGGCTGGCGATATGTTCAAGAATCTCGACACGCGA
GAGCAAATGGCTGAGCGAGGCAACGAGAAGTCGCTTGAGGAGGTGGAGGAGTTCAAAGACAGCCCAAGCCGCAAG
CGTTGGGTTTTTACCGTCTATTTCTTAACTTGGTTTGTGCCCGACTTTCTCATCAGATGGATGGGACGCATGCCG
CGTAAAGATGTCCGCATGGCGTGGAGGGAAAAGGTGGCCATCAACATGCTCATCTGGCTTCTATGCTTGATTGCC
GCCTTCTTCATCGTCGTCTTTCCCGCACTCATCTGCCCGAAGCAAAATGTCTACAGCGCCCAGGAGCTCTCGGAA
TACGATGGCGAGCCGAACAGCAAAGGGGCTTACGTGTCTATTCGTGGCTACGTCGTTGATCTCGGTGCCTACGTC
TCCCATCATTACCCGCCCTATCTAGACAAAAAAGCTCTTACGAAGTACGCCGGCAAGGATGTCAGCTCTCTCTTC
CCTGTCCAAGTCTCGGCTTTGTGCCATGGAGTTAGCGGCTCCGTCAACGACGAGGTCACGCTCGACTACAAGAAC
ACCAACATAACAGAATCCCCGACCCTCGTCAACTTGCAGGACGTCAACGCAAAGTATCACGATTTCCGGCACTTT
ACGAACGACTCGAGGCCAGACTGGTATCAAGAACAGCTGGTGAAACTCCGAGGGACCTGGGGCAAGGGAAATATT
GGTTACTCGGCGGAATACGTCAGCACTCTGGCTCAGAAGCAACAGACGATCGCCATCATCGGACACCGGGTTTAC
GATCTGACCACCTATCTTCATGGCGGACGCAAGATGCGGGCCAAGGCCGGCGAGAAGCCGCCCAACGACCCTTCG
CTGGCGGACTTCATGGATGTCGAAGTACTGCAGTTGTTCCAGAGCAAGGCCGGAACCGATATCACTAAGTTCTGG
CACTTGCTGGACATCACGCCGGAGGTCAGGGCCAGGATGCAGACCTGCCTCGACTACCTGTTCTACGTTGGCGAT
GTCGACACGAGAAGGTCGGCTAGGTGCCAGTTCGCCGAGTACCTAGTTCTGTCGGTCTCGTGCCTCCTGGCATCG
GTCATCGCCTTCAAATTCTTCGCGGCGCTTCAGTTCGGCGGCAAGAATGTGCCGGAAAACCTGGACAAGTTCGTC
ATGTGCCAGATTCCGGCCTACACTGAGGACGAGGACTCGCTACGGCGCGCCATCGACTCTGCGGCCCGCATGCGT
TACGACGACAAGCGTAAGCTCCTAGTCGTTGTGTGCGATGGCATGATCGTTGGCCAAGGCAACGACAGGCCGACG
CCGCGCATCGTGCTCGACATCCTCGGCGTCTCAGAGTCCGTCGACCCCGAACCGCTCAGCTTCGAGTCGCTTGGT
GAAGGTCAAAAGCAGCACAACATGGGCAGGGTCTACTCAGGCCTCTACGAGGTTCAGGGCCACATTGTGCCGTTC
CTGGTTATCGTCAAGGTCGGGAAGCCGTCCGAGGTCGTGCGTCCCGGGAATCGTGGCAAGCGGGACTCGCAGATG
GTCATCATGCGCTTCCTGAACCGCGTACACTACAACCTACCCATGAGTCCGTTGGAACTTGAGATGTATCACCAG
ATCCGCAACATCATCGGCGTAAACCCGACCTTTTACGAATTTATGCTGCAGATTGACGCCGATACCGTCGTGGCG
CCCGACTCGGCGACTCGCATGGTGTCTGCGTTTCTCGACGATACGCTCCTGATTGCTGTCTGTGGCGAGACGGCG
CTGACCAATGCCAAGTCGTCCTTCATCACCATGATCCAGGTGTATGAGTACTACATCTCGCACAACTTGTCCAAG
GCCTTTGAGAGTCTCTTCGGCTCCGTCACCTGCCTGCCCGGCTGCTTCTCCATGTACCGCATCCGCGCGGCTGAG
ACTGGCAAGCCGCTGTTCGTCAGCCGCGAGGTTGTCGAAGCCTACGCCACGATCCGCGTCGATACGCTGCACATG
AAGAACCTACTGCACCTGGGTGAAGATCGCTATCTGACGACGCTGCTACTAAAATATCACTCCAAGTACAAGACG
AAATACATCTTTACGGCTCATGCGTGGACCATCGCCCCCGATTCTTGGCAGGTCTTTCTCTCGCAGCGTCGGCGA
TGGATCAACTCGACCGTCCACAACCTCATTGAGCTTATCCCGATGAACCAGCTCTGCGGCTTCTGTTGCTTCAGC
ATGCGCTTCATCGTCTTCATCGACTTGTTGAGCACCGTCGTCCAGCCGGTAACGATTGCCTATATAATCTACCTG
GTGACACTAGTGGCGACGAGGGCGACGCTTGTGCCCATCACCGCCTTTGTCCTGCTCGGCGCCATCTACGGTCTG
CAAGCTATTATCTTCATCCTGCGCCGCAAGTGGGAGATGGTCGGCTGGATGATTCTCTACGTCCTCGCCGTACCT
GTCTTCAGTTTTGGTCTGCCGCTCTACGCCTTCTGGCACATGGACGATTTCAACTGGGGCAATACACGTGTCGTT
GCGGGCGAAAAGGGCAAAAAGGTCGTCATCTCGGACGAGGGCAAATTCGATCCCAGCTCCATTCCGCGCAAGAAG
TGGGAGGAGTACCAGGCAGAGCTCTGGGAGACGCAGACGTCGCGCGAAGACGCCAGGTCTGAGATCTCGGCCTTC
AGCTATGGCACCAAGGCCCAGCCGCTGGTGTCCGAGTACGCGTTCCCCAGCCGGCCGGGGTCGACGACGGGCTTC
GCCGGCCATCCATCGATGACTCACATTCCCTACGACTCACGCAACGTGTCGCGCATGTCCTTGGTCGCGTCTGAG
TCCCCCGGCAACCGTATGAGCCACTTCAGCGGCACCCAGTACTTCAACCCGGATGACATGGTCGGCCTGCCCAGC
GACGATGCACTCTTGGCCGAGATACGCGACATTTTGCGGACGGCCGATCTAATGACGGTGACGAAGAAGGGCGTC
AAGCAAGAGCTAGAGCGTCGATTCGATGTGCCGCTAGATATCAAGCGAGCCTATATCAACAGCGCGACCGAGGCT
ATCCTATCCGGCCAGCTTTAA
Gene >Ophcf2|04235
ATGGCCTCGACTCTTCCTCCCCTGGCCACGGGCAATGGAGGAGCTCACACCCAACATTCTCTGCCGTCACTGCCG
GCTCATCTCCAATCGGACACGCACATCACCGGCCATCTGGCCAGTCGCTTCCACGCGTCTCATCCCACCGCCACC
CTTTCCTCCCATGGCCTTGTCTGCCTCAACACATACACCTCCTCCGCCAGGGGGCCTGATGGCGGCAAGGCCGGC
AGCGCCATGGCCGGTGCCGAAGACATGGCCCACCACGCCTGGATGAGGCTCGGTCGCCGCTCAGAGAGCCAGGCC
GTCGTCTTCCTGTGAGTCGCACCCGTGCTCCACCCTCACTTCTCGCTTGCCCACTCACCGGTGTTCCCCAGTGGC
GAGTCGGGATCGGGAAAGTCGACCGTCCGTAATCATATGCTCTCGGCACTGCTTGACAAGTCTTCCTCGCCTTTG
TCGACCAAGCTCTCACTGGCTGCCTATGTCTTCGACACTCTCACCACGACCAAGACGGCCACCACGCCCACGGCC
TCAAAGTCTGGTCTGTTCTACGAATTGCAATACGACACTACCAGCACCACCCACCCGACCTTAATTGGTGGCAAA
GTCCTGGATCACAGGCTGGAGAGGAGTCGGATCACCGACGTGCCCTCGGGCGAGCGTAACTTCCACATCCTCTAC
TATCTCCTGGCCGGCACTAGCGAGGCCGAGAAGACACATCTAGGGCTCGATGGCGCCAAGAGATGGAAGTACCTC
GGGCACCCGACTCAGCTCAAGGTCGGCATCAACGACGCCGAAGGCTTCCAGCTCTTCAAAAGCGCCCTTAAGAAG
CTCGAATTTCCGAGGGGCGAGATTGCTGAGATTTGTCAAATCTTAGCCACCATCCTCCACATCGGCCAGCTCGAG
TTCGAGTCGACCAGCAACACCAGCGCCACTGGCGATGAGAGCGGCGGCTTCTCACACGATGGCGGCATCACTTCC
ACCACGGTCAAGAATAAGGATGTCCTCGGCATCATCGCCGCTTTCCTCGGTGTCAGCACCGGCGACCTCCAAAGC
ACTCTCGGCTATAAGACCAAGACGATACAGAAGGAGCGCGTGACCGTTTTGCTCGATCCCAACGGCGCCCGCGCT
CATGCCAACGAGCTTGCTCGCACTTTGTATTCCCTGTTAGTAGCCTGGATCATCGAAAACGCTAATCAGAGGATC
TGCGCCCTGGACGACGGCGTCGCCAACACCATATCTCTCGTCGACTTCCCCGGCTTCGCCCAACAGCCGTCCACC
AGCTCAACGATGGACCAGCTCCTGAATAACGCCGCCACTGAAGCCATCTACAACCTGGCGCTTCACAACTTTTTC
GACCGCAAGGCGGATATGCTCGAGTCGGAGGAAGTAACAGTCGCCCCGACCAGCTACTTTGACAATTCCGACGCT
GTCAAGGGTCTGCTCAAGCCTGGAAATGGTCTCTTGAGCATCCTTGATGATCAGACGAGGCGCAATAGGACCGAC
ATGCAGCTCCTGGAAAGTTTTCGAAAACGTTTCGAAGGCAAAAACCCGGCTATCGAGGTCAGCTCGTCCACGGCG
AAGCTCCCTGGCAGCAACTTTTTGACAGAGAACACGGCCGCTTCATTCACCGTCAAGCACTTCGCCGGCGAGGTC
AACTACCCCGTCAAGGGCCTGGTCGAGGAAAACGGCGAAGTCATTTCGGTCGATCTGCTCAATATGTTCAACGCG
ACCAAGAGCGAGTTCATTGGCAGGCTATTCGGACAGGACGCCCTGCAGACTATAGCCCATCCTGGTGAAAAGACT
TCTGTTCTTCAGGCGTCCGTCAGTTCCAAGCCGATGCGGGCCCCAAGCGTCATGACGCGATCGGGCACACGCCCA
AAGGGCTCGATTCCTCGACGACATCTGGAGTCGTTGGATCCGAAGGATCAGAAGGGGGAAGGCATCGAGAAGCAA
GGCAATGCCAAGGGCTCGTCCGAACTGGGAGCCTCGGGCCAATTTCTGTCGTCTCTCGACAATGTGCAGAAGGCC
GTTACGGACCCAGGCACCAATTCCTACTTCGTCTTCTGCCTGAAGACAAATGATCGCCGCATTGCGAACCAATTC
GATAGTAAATGCGTACGAACCCAGGTGCAGACGTTTGGCATCGCCGAGATCAGTCAGAGACTGCGCTCGGCTGAC
TTCAGTATCTTCCTCCCTTTCGGCGAGTTTCTTGGAATGGCTGATGCCGAGACGATTCTTGTCGGCAGCGAGCGC
GAACGGGTCGAAATGATTATCGACGAGAAGGTATGGCCCAGAAACGAGGTGCAAGTCGGCTCTACCGGCGTCTTT
CTGAGCGAGAGGTGTTGGATGGAAGTCGCCCACTTTTCGGATGAGAAGGCAGCCGGACGCTTCGGCATGGGAGGC
GAGGGTGGTGAAGCCGGGGAGGGGCCCGCTTTCACTGAGCAGCTCGGGTTCACCGCCTCAAAGGAGCAGCTTCTG
TCGTCCGGCAACACACCTTTGATGTACGCGGAGAAGGCCAAAGCCGGCTACTTCACCGGCTCGGATGACACTCGG
TCCGAAGCAGGCGTTTCGGCACTTGGGGCTGGCGATATGTTCAAGAATCTCGACACGCGAGAGCAAATGGCTGAG
CGAGGCAACGAGAAGTCGCTTGAGGAGGTGGAGGAGTTCAAAGACAGCCCAAGCCGCAAGCGTTGGGTTTTTACC
GTCTATTTCTTAACTTGGTTTGTGCCCGACTTTCTCATCAGATGGATGGGACGCATGCCGCGTAAAGATGTCCGC
ATGGCGTGGAGGGAAAAGGTGGCCATCAACATGCTCATCTGGCTTCTATGCTTGATTGCCGCCTTCTTCATCGTC
GTCTTTCCCGCACTCATCTGCCCGAAGCAAAATGTCTACAGCGCCCAGGAGCTCTCGGAATACGATGGCGAGCCG
AACAGCAAAGGGGCTTACGTGTCTATTCGTGGCTACGTCGTTGATCTCGGTGCCTACGTCTCCCATCATTACCCG
CCCTATCTAGACAAAAAAGCTCTTACGAAGTACGCCGGCAAGGATGTCAGCTCTCTCTTCCCTGTCCAAGTCTCG
GCTTTGTGCCATGGAGTTAGCGGCTCCGTCAACGACGAGGTCACGCTCGACTACAAGAACACCAACATAACAGAA
TCCCCGACCCTCGTCAACTTGCAGGACGTCAACGCAAAGTATCACGATTTCCGGCACTTTACGAACGACTCGAGG
CCAGACTGGTATCAAGAACAGCTGGTGAAACTCCGAGGGACCTGGGGCAAGGGAAATATTGGTTACTCGGCGGAA
TACGTCAGCACTCTGGCTCAGAAGCAACAGACGATCGCCATCATCGGACACCGGGTTTACGATCTGACCACCTAT
CTTCATGGCGGACGCAAGATGCGGGCCAAGGCCGGCGAGAAGCCGCCCAACGACCCTTCGCTGGCGGACTTCATG
GATGTCGAAGTACTGCAGTTGTTCCAGAGCAAGGCCGGAACCGATATCACTAAGTTCTGGCACTTGCTGGACATC
ACGCCGGAGGTCAGGGCCAGGATGCAGACCTGCCTCGACTACCTGTTCTACGTTGGCGATGTCGACACGAGAAGG
TCGGCTAGGTGCCAGTTCGCCGAGTACCTAGTTCTGTCGGTCTCGTGCCTCCTGGCATCGGTCATCGCCTTCAAA
TTCTTCGCGGCGCTTCAGTTCGGCGGCAAGAATGTGCCGGAAAACCTGGACAAGTTCGTCATGTGCCAGATTCCG
GCCTACACTGAGGACGAGGACTCGCTACGGCGCGCCATCGACTCTGCGGCCCGCATGCGTTACGACGACAAGCGT
AAGCTCCTAGTCGTTGTGTGCGATGGCATGATCGTTGGCCAAGGCAACGACAGGCCGACGCCGCGCATCGTGCTC
GACATCCTCGGCGTCTCAGAGTCCGTCGACCCCGAACCGCTCAGCTTCGAGTCGCTTGGTGAAGGTCAAAAGCAG
CACAACATGGGCAGGGTCTACTCAGGCCTCTACGAGGTTCAGGGCCACATTGTGCCGTTCCTGGTTATCGTCAAG
GTCGGGAAGCCGTCCGAGGTCGTGCGTCCCGGGAATCGTGGCAAGCGGGACTCGCAGATGGTCATCATGCGCTTC
CTGAACCGCGTACACTACAACCTACCCATGAGTCCGTTGGAACTTGAGATGTATCACCAGATCCGCAACATCATC
GGCGTAAACCCGACCTTTTACGAATTTATGCTGCAGATTGACGCCGATACCGTCGTGGCGCCCGACTCGGCGACT
CGCATGGTGTCTGCGTTTCTCGACGATACGCTCCTGATTGCTGTCTGTGGCGAGACGGCGCTGACCAATGCCAAG
TCGTCCTTCATCACCATGATCCAGGTGTATGAGTACTACATCTCGCACAACTTGTCCAAGGCCTTTGAGAGTCTC
TTCGGCTCCGTCACCTGCCTGCCCGGCTGCTTCTCCATGTACCGCATCCGCGCGGCTGAGACTGGCAAGCCGCTG
TTCGTCAGCCGCGAGGTTGTCGAAGCCTACGCCACGATCCGCGTCGATACGCTGCACATGAAGAACCTACTGCAC
CTGGGTGAAGATCGCTATCTGACGACGCTGCTACTAAAATATCACTCCAAGTACAAGACGAAATACATCTTTACG
GCTCATGCGTGGACCATCGCCCCCGATTCTTGGCAGGTCTTTCTCTCGCAGCGTCGGCGATGGATCAACTCGACC
GTCCACAACCTCATTGAGCTTATCCCGATGAACCAGCTCTGCGGCTTCTGTTGCTTCAGCATGCGCTTCATCGTC
TTCATCGACTTGTTGAGCACCGTCGTCCAGCCGGTAACGATTGCCTATATAATCTACCTGGTGACACTAGTGGCG
ACGAGGGCGACGCTTGTGCCCATCACCGCCTTTGTCCTGCTCGGCGCCATCTACGGTCTGCAAGCTATTATCTTC
ATCCTGCGCCGCAAGTGGGAGATGGTCGGCTGGATGATTCTCTACGTCCTCGCCGTACCTGTCTTCAGTTTTGGT
CTGCCGCTCTACGCCTTCTGGCACATGGACGATTTCAACTGGGGCAATACACGTGTCGTTGCGGGCGAAAAGGGC
AAAAAGGTCGTCATCTCGGACGAGGGCAAATTCGATCCCAGCTCCATTCCGCGCAAGAAGTGGGAGGAGTACCAG
GCAGAGCTCTGGGAGACGCAGACGTCGCGCGAAGACGCCAGGTCTGAGATCTCGGCCTTCAGCTATGGCACCAAG
GCCCAGCCGCTGGTGTCCGAGTACGCGTTCCCCAGCCGGCCGGGGTCGACGACGGGCTTCGCCGGCCATCCATCG
ATGACTCACATTCCCTACGACTCACGCAACGTGTCGCGCATGTCCTTGGTCGCGTCTGAGTCCCCCGGCAACCGT
ATGAGCCACTTCAGCGGCACCCAGTACTTCAACCCGGATGACATGGTCGGCCTGCCCAGCGACGATGCACTCTTG
GCCGAGATACGCGACATTTTGCGGACGGCCGATCTAATGACGGTGACGAAGAAGGGCGTCAAGCAAGAGCTAGAG
CGTCGATTCGATGTGCCGCTAGATATCAAGCGAGCCTATATCAACAGCGGTATGTCCCGAACAACCTCCTCCACC
CGTTTTTACCGCAGCGGAGAACTGACATCACCACAGCGACCGAGGCTATCCTATCCGGCCAGCTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail