Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04234
Gene name
Locationscaffold_04:1234506..1238037
Strand+
Gene length (bp)3531
Transcript length (bp)3474
Coding sequence length (bp)3474
Protein length (aa) 1158

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11707 Npa1 Ribosome 60S biogenesis N-terminal 1.5E-90 98 440
PF16201 NopRA1 Nucleolar pre-ribosomal-associated protein 1 2.2E-56 901 1089

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.292 0.9084 0.1449 0.0388 0.1157 0.0022 0.0788 0.0262 0.0423 0.0062

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 25.83 14.82 36.85
Alive In ants, during behavior modification 20.12 11.36 28.87
Dead In ants, recently dead 24.76 14.13 35.39

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.194912 no
Alive Dead 0.220006 no
Dead Fungus 0.855389 no

Orthologs

Orthofinder run ID4
Orthogroup1143
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6771
Ophiocordyceps australis map64 (Brazil) OphauB2|7315
Ophiocordyceps camponoti-floridani Ophcf2|04234 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1503
Ophiocordyceps kimflemingae Ophio5|2398
Ophiocordyceps subramaniannii Hirsu2|10211
Ophiocordyceps subramaniannii Hirsu2|10212

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04234
MGKRPSSRIDGPTAHRKRQRITIDAPAGEDVSSCDHLRSLLVLDQDLRKARHGLQSLKKLLDDIISDHANRRDKV
CILQQYLDASKPRDAGEDAIYLRDIMDMWSFAVQVNDDGVMSSVAVVLALLLSVVSQSLQLVPHGLGLCQTLLQE
RQLKLLSKNLASDNRKAFIISPTLRLLREAVCLDGGAYAKAIVRAGTYTFTSLARNLELGSSGQGTEDAGKSSIR
TNAVHFFLSCLKHVSSQGRKELLSQRHLFSRLTYFIKTDPPQVALAILDALQSHVLMDPKIPRGVKFRNFNTRTL
LRLLALYGLPGGDSDEGNPVSDRAHDFLMYACTSPGAGILLPYRGLYPKESSDEQSDDIAARQVESKPGDSQAAH
ENQSLCVHNFAMSEFAAKLRPWASTKQSQLLLAMFTAAPELIAHYFHDNRFFTFEPKVSMTWVGYAAFLFDTISI
PLRPSFGDSVRYADGPPPAAVLLDNILPPAITQKVLVRCFSPKSESDVTALFATKILVAALEKLVTTLEMLDPAQ
GRKEAKWSETARRLEDAFCQRVPEMKQIVLCYKGISKENSMHRTLASRLLLLYYRVIPRVALAASFDVSPLLTTV
LKGLRQDGPEPGARQLSLIELEGLVTIASYSPGMRWFSRSEGPRREFSTSAFVALLQLLCGDDDHTPFRHLKEAL
ASVAGESQLVSKSTGLKPLLATLQLTVTRVDTGDMELIWAFLDNCTGRCVASPIKYIEILETLSAERTDSPAAEE
DDGSLSLLTLALVEQLPFAVKTGDKKSIKPLARFLSLYFNACYLWEGQGEVIKALHQQLRCTLSEIKVKMTALGE
TSDVTALKATESASDNNHDPSRVTDGQLKKPGELGLHQQLHGSPLDEGDAAVLAKCISKTLEDVIEDGWVVKLGR
LLLSEHTHIRKEALTGILKVAARVKDSALEERSQIWLLLSELAESSRPQIESGPVPSAFVAFVMHALDVVQSPLH
PLYPKLNRYLTRSPMWPPDKLPLAHDILHGEPSEDDKYYIEIAWLLDYLLDSLRTQRDMDVFHGKKWLEKLLALG
SNPYLRTGLRTRLLKLVYRASCIQGGSTTLVTRFGILSWLRGQRAAADAADEAAVCEHLMRRVWDTCDRHRVSAW
SHGGAQTLVQRVACQRRGAPIISSTFYDAQSQ*
Coding >Ophcf2|04234
ATGGGCAAGAGACCCTCTTCTCGCATCGACGGCCCGACTGCGCATCGTAAGCGGCAACGGATAACTATCGACGCC
CCGGCCGGTGAAGACGTCTCCTCCTGCGACCATTTGCGCAGCTTGCTAGTCTTGGATCAAGACCTTCGCAAGGCG
CGGCACGGTCTTCAATCTTTGAAGAAGCTCCTCGACGACATCATCTCCGACCACGCCAACCGACGAGACAAGGTC
TGCATCCTCCAACAATACCTCGATGCTAGTAAACCAAGAGATGCGGGTGAAGATGCCATCTACCTCCGCGACATC
ATGGACATGTGGTCTTTCGCTGTCCAGGTAAATGATGATGGCGTCATGTCCTCCGTTGCCGTCGTCTTGGCTCTA
CTTCTCAGCGTCGTCTCCCAGTCTTTGCAGTTGGTGCCTCATGGTCTCGGACTTTGCCAGACGCTCCTTCAGGAA
AGGCAACTAAAGCTGCTATCCAAAAACTTGGCCTCTGATAACCGGAAAGCCTTCATCATCTCCCCTACGCTACGT
TTGCTGCGGGAAGCTGTTTGCCTGGACGGCGGTGCTTACGCCAAGGCCATCGTTCGAGCTGGTACCTATACCTTT
ACCTCTCTGGCCCGGAATCTGGAGCTTGGAAGCTCAGGTCAAGGAACTGAGGATGCTGGCAAATCATCAATCAGG
ACGAATGCCGTCCATTTCTTTCTGAGCTGCCTCAAACACGTCAGCTCACAGGGCCGAAAGGAGCTCCTTTCGCAG
AGACACCTCTTCTCTCGACTGACGTACTTCATCAAAACCGATCCGCCACAAGTCGCCTTGGCAATACTGGACGCA
CTTCAGTCACATGTGCTCATGGATCCCAAGATACCGCGCGGTGTCAAGTTTCGCAACTTTAATACCAGGACACTG
TTGAGACTACTAGCCCTTTATGGTCTGCCGGGCGGCGACTCGGATGAGGGGAATCCTGTCAGTGACAGGGCTCAC
GACTTTCTCATGTACGCTTGCACGTCACCCGGTGCTGGCATTCTCCTCCCTTACAGGGGCCTGTACCCGAAGGAG
TCCAGCGACGAACAATCGGACGACATAGCCGCCAGACAAGTCGAAAGCAAACCCGGAGACAGTCAGGCTGCTCAT
GAGAATCAGAGCCTCTGTGTACATAATTTCGCCATGTCGGAATTCGCCGCCAAGCTCCGCCCGTGGGCCAGCACG
AAACAGAGTCAACTTCTCTTGGCCATGTTCACGGCCGCCCCAGAACTCATCGCTCACTACTTTCACGACAACCGA
TTCTTCACCTTTGAACCCAAGGTGTCCATGACCTGGGTCGGGTACGCTGCCTTCCTCTTCGACACCATCAGCATC
CCCCTGCGTCCTTCATTTGGGGACTCTGTGCGGTATGCTGACGGCCCTCCTCCCGCGGCCGTTTTGCTGGATAAC
ATCCTGCCTCCCGCCATCACTCAGAAAGTCCTCGTTCGATGTTTTTCGCCAAAGTCGGAGTCGGACGTGACGGCT
CTTTTTGCCACAAAGATACTCGTCGCCGCTCTGGAGAAGCTTGTCACGACCCTCGAGATGCTGGATCCGGCGCAG
GGTCGAAAGGAGGCCAAGTGGTCGGAAACGGCCCGACGGCTCGAAGATGCCTTTTGTCAGCGGGTGCCCGAAATG
AAGCAAATCGTCCTATGTTACAAGGGGATTTCCAAAGAAAACTCAATGCACAGGACTTTGGCGAGCCGTCTTTTA
CTGCTCTACTACCGAGTAATCCCCCGCGTGGCTCTGGCCGCCAGCTTTGATGTCTCGCCCTTGCTCACGACTGTG
CTGAAAGGGCTGCGGCAAGACGGGCCAGAGCCTGGCGCCCGACAGCTCAGCCTCATTGAGTTGGAGGGTCTCGTG
ACGATAGCCAGTTACTCGCCTGGCATGAGGTGGTTTTCCAGATCCGAAGGCCCGCGTCGTGAATTTTCAACCTCG
GCGTTCGTCGCCCTGCTCCAGCTTCTCTGTGGCGATGACGATCATACTCCCTTTCGTCACCTCAAAGAAGCGTTG
GCTAGCGTTGCTGGGGAGAGCCAACTCGTCTCAAAGTCGACAGGCTTGAAACCGCTGCTGGCGACCCTGCAACTC
ACTGTCACTCGGGTTGACACGGGGGACATGGAATTGATATGGGCATTCTTGGATAATTGCACAGGCCGCTGCGTC
GCCTCTCCGATCAAGTACATCGAAATCTTGGAAACCCTATCGGCTGAGCGGACTGATAGTCCGGCGGCAGAGGAA
GACGACGGATCACTGTCATTGCTCACCCTGGCACTTGTCGAGCAGCTGCCGTTTGCCGTGAAAACCGGCGACAAG
AAGAGTATCAAGCCTCTCGCGCGATTTCTCTCACTCTACTTCAATGCGTGCTATCTCTGGGAGGGTCAAGGCGAA
GTCATCAAGGCTCTACATCAACAACTGCGCTGTACATTGTCAGAGATTAAAGTCAAGATGACTGCTTTGGGAGAA
ACCAGCGATGTGACAGCGTTGAAAGCGACGGAGTCTGCTTCCGACAACAATCATGATCCCTCCCGCGTCACGGAT
GGACAACTGAAAAAGCCGGGCGAGTTGGGTCTGCATCAACAGCTCCACGGGTCCCCCTTGGACGAAGGTGACGCG
GCAGTCCTCGCAAAATGCATCTCGAAGACCTTGGAAGACGTGATAGAGGACGGATGGGTCGTCAAGTTGGGACGA
CTCTTGTTATCGGAGCATACGCACATCCGCAAAGAGGCTCTCACCGGCATCCTCAAAGTCGCAGCTCGTGTCAAG
GACTCGGCTCTCGAGGAACGCTCGCAGATCTGGCTGCTTCTTTCAGAGCTTGCCGAGTCGTCAAGGCCACAGATT
GAGTCAGGCCCCGTCCCATCAGCTTTTGTGGCCTTCGTCATGCACGCCCTCGACGTGGTACAGAGTCCACTGCAT
CCGCTGTATCCAAAACTGAATCGCTACCTCACCCGCAGCCCAATGTGGCCGCCGGACAAGCTGCCGCTCGCCCAC
GACATCCTCCACGGCGAGCCGTCAGAGGACGACAAGTACTACATCGAGATCGCCTGGCTCCTGGACTATCTCCTC
GATAGCCTGCGGACGCAGCGTGACATGGACGTCTTCCACGGCAAGAAATGGCTCGAGAAGCTGCTCGCGCTCGGA
AGCAACCCCTACCTCAGGACCGGGCTGCGAACCAGGCTCCTCAAGCTTGTCTACCGAGCAAGCTGCATACAAGGC
GGCAGCACCACCCTCGTCACAAGGTTCGGCATCCTCAGCTGGCTACGTGGACAACGAGCGGCAGCCGACGCGGCC
GACGAGGCTGCTGTTTGCGAGCATCTGATGCGCCGCGTATGGGACACGTGTGACCGTCATCGCGTTTCTGCCTGG
AGCCATGGCGGCGCGCAGACGCTCGTCCAAAGAGTGGCCTGCCAGCGAAGGGGCGCGCCGATCATATCGTCCACA
TTTTACGACGCTCAATCGCAATAG
Transcript >Ophcf2|04234
ATGGGCAAGAGACCCTCTTCTCGCATCGACGGCCCGACTGCGCATCGTAAGCGGCAACGGATAACTATCGACGCC
CCGGCCGGTGAAGACGTCTCCTCCTGCGACCATTTGCGCAGCTTGCTAGTCTTGGATCAAGACCTTCGCAAGGCG
CGGCACGGTCTTCAATCTTTGAAGAAGCTCCTCGACGACATCATCTCCGACCACGCCAACCGACGAGACAAGGTC
TGCATCCTCCAACAATACCTCGATGCTAGTAAACCAAGAGATGCGGGTGAAGATGCCATCTACCTCCGCGACATC
ATGGACATGTGGTCTTTCGCTGTCCAGGTAAATGATGATGGCGTCATGTCCTCCGTTGCCGTCGTCTTGGCTCTA
CTTCTCAGCGTCGTCTCCCAGTCTTTGCAGTTGGTGCCTCATGGTCTCGGACTTTGCCAGACGCTCCTTCAGGAA
AGGCAACTAAAGCTGCTATCCAAAAACTTGGCCTCTGATAACCGGAAAGCCTTCATCATCTCCCCTACGCTACGT
TTGCTGCGGGAAGCTGTTTGCCTGGACGGCGGTGCTTACGCCAAGGCCATCGTTCGAGCTGGTACCTATACCTTT
ACCTCTCTGGCCCGGAATCTGGAGCTTGGAAGCTCAGGTCAAGGAACTGAGGATGCTGGCAAATCATCAATCAGG
ACGAATGCCGTCCATTTCTTTCTGAGCTGCCTCAAACACGTCAGCTCACAGGGCCGAAAGGAGCTCCTTTCGCAG
AGACACCTCTTCTCTCGACTGACGTACTTCATCAAAACCGATCCGCCACAAGTCGCCTTGGCAATACTGGACGCA
CTTCAGTCACATGTGCTCATGGATCCCAAGATACCGCGCGGTGTCAAGTTTCGCAACTTTAATACCAGGACACTG
TTGAGACTACTAGCCCTTTATGGTCTGCCGGGCGGCGACTCGGATGAGGGGAATCCTGTCAGTGACAGGGCTCAC
GACTTTCTCATGTACGCTTGCACGTCACCCGGTGCTGGCATTCTCCTCCCTTACAGGGGCCTGTACCCGAAGGAG
TCCAGCGACGAACAATCGGACGACATAGCCGCCAGACAAGTCGAAAGCAAACCCGGAGACAGTCAGGCTGCTCAT
GAGAATCAGAGCCTCTGTGTACATAATTTCGCCATGTCGGAATTCGCCGCCAAGCTCCGCCCGTGGGCCAGCACG
AAACAGAGTCAACTTCTCTTGGCCATGTTCACGGCCGCCCCAGAACTCATCGCTCACTACTTTCACGACAACCGA
TTCTTCACCTTTGAACCCAAGGTGTCCATGACCTGGGTCGGGTACGCTGCCTTCCTCTTCGACACCATCAGCATC
CCCCTGCGTCCTTCATTTGGGGACTCTGTGCGGTATGCTGACGGCCCTCCTCCCGCGGCCGTTTTGCTGGATAAC
ATCCTGCCTCCCGCCATCACTCAGAAAGTCCTCGTTCGATGTTTTTCGCCAAAGTCGGAGTCGGACGTGACGGCT
CTTTTTGCCACAAAGATACTCGTCGCCGCTCTGGAGAAGCTTGTCACGACCCTCGAGATGCTGGATCCGGCGCAG
GGTCGAAAGGAGGCCAAGTGGTCGGAAACGGCCCGACGGCTCGAAGATGCCTTTTGTCAGCGGGTGCCCGAAATG
AAGCAAATCGTCCTATGTTACAAGGGGATTTCCAAAGAAAACTCAATGCACAGGACTTTGGCGAGCCGTCTTTTA
CTGCTCTACTACCGAGTAATCCCCCGCGTGGCTCTGGCCGCCAGCTTTGATGTCTCGCCCTTGCTCACGACTGTG
CTGAAAGGGCTGCGGCAAGACGGGCCAGAGCCTGGCGCCCGACAGCTCAGCCTCATTGAGTTGGAGGGTCTCGTG
ACGATAGCCAGTTACTCGCCTGGCATGAGGTGGTTTTCCAGATCCGAAGGCCCGCGTCGTGAATTTTCAACCTCG
GCGTTCGTCGCCCTGCTCCAGCTTCTCTGTGGCGATGACGATCATACTCCCTTTCGTCACCTCAAAGAAGCGTTG
GCTAGCGTTGCTGGGGAGAGCCAACTCGTCTCAAAGTCGACAGGCTTGAAACCGCTGCTGGCGACCCTGCAACTC
ACTGTCACTCGGGTTGACACGGGGGACATGGAATTGATATGGGCATTCTTGGATAATTGCACAGGCCGCTGCGTC
GCCTCTCCGATCAAGTACATCGAAATCTTGGAAACCCTATCGGCTGAGCGGACTGATAGTCCGGCGGCAGAGGAA
GACGACGGATCACTGTCATTGCTCACCCTGGCACTTGTCGAGCAGCTGCCGTTTGCCGTGAAAACCGGCGACAAG
AAGAGTATCAAGCCTCTCGCGCGATTTCTCTCACTCTACTTCAATGCGTGCTATCTCTGGGAGGGTCAAGGCGAA
GTCATCAAGGCTCTACATCAACAACTGCGCTGTACATTGTCAGAGATTAAAGTCAAGATGACTGCTTTGGGAGAA
ACCAGCGATGTGACAGCGTTGAAAGCGACGGAGTCTGCTTCCGACAACAATCATGATCCCTCCCGCGTCACGGAT
GGACAACTGAAAAAGCCGGGCGAGTTGGGTCTGCATCAACAGCTCCACGGGTCCCCCTTGGACGAAGGTGACGCG
GCAGTCCTCGCAAAATGCATCTCGAAGACCTTGGAAGACGTGATAGAGGACGGATGGGTCGTCAAGTTGGGACGA
CTCTTGTTATCGGAGCATACGCACATCCGCAAAGAGGCTCTCACCGGCATCCTCAAAGTCGCAGCTCGTGTCAAG
GACTCGGCTCTCGAGGAACGCTCGCAGATCTGGCTGCTTCTTTCAGAGCTTGCCGAGTCGTCAAGGCCACAGATT
GAGTCAGGCCCCGTCCCATCAGCTTTTGTGGCCTTCGTCATGCACGCCCTCGACGTGGTACAGAGTCCACTGCAT
CCGCTGTATCCAAAACTGAATCGCTACCTCACCCGCAGCCCAATGTGGCCGCCGGACAAGCTGCCGCTCGCCCAC
GACATCCTCCACGGCGAGCCGTCAGAGGACGACAAGTACTACATCGAGATCGCCTGGCTCCTGGACTATCTCCTC
GATAGCCTGCGGACGCAGCGTGACATGGACGTCTTCCACGGCAAGAAATGGCTCGAGAAGCTGCTCGCGCTCGGA
AGCAACCCCTACCTCAGGACCGGGCTGCGAACCAGGCTCCTCAAGCTTGTCTACCGAGCAAGCTGCATACAAGGC
GGCAGCACCACCCTCGTCACAAGGTTCGGCATCCTCAGCTGGCTACGTGGACAACGAGCGGCAGCCGACGCGGCC
GACGAGGCTGCTGTTTGCGAGCATCTGATGCGCCGCGTATGGGACACGTGTGACCGTCATCGCGTTTCTGCCTGG
AGCCATGGCGGCGCGCAGACGCTCGTCCAAAGAGTGGCCTGCCAGCGAAGGGGCGCGCCGATCATATCGTCCACA
TTTTACGACGCTCAATCGCAATAG
Gene >Ophcf2|04234
ATGGGCAAGAGACCCTCTTCTCGCATCGACGGCCCGACTGCGCATCGTAAGCGGCAACGGATAACTATCGACGCC
CCGGCCGGTGAAGACGTCTCCTCCTGCGACCATTTGCGCAGCTTGCTAGTCTTGGATCAAGACCTTCGCAAGGCG
CGGCACGGTTGGCCATCTCTCTCATGACCTTTGACATTAGGTTCATACTGATCACAAATTCAAGGTCTTCAATCT
TTGAAGAAGCTCCTCGACGACATCATCTCCGACCACGCCAACCGACGAGACAAGGTCTGCATCCTCCAACAATAC
CTCGATGCTAGTAAACCAAGAGATGCGGGTGAAGATGCCATCTACCTCCGCGACATCATGGACATGTGGTCTTTC
GCTGTCCAGGTAAATGATGATGGCGTCATGTCCTCCGTTGCCGTCGTCTTGGCTCTACTTCTCAGCGTCGTCTCC
CAGTCTTTGCAGTTGGTGCCTCATGGTCTCGGACTTTGCCAGACGCTCCTTCAGGAAAGGCAACTAAAGCTGCTA
TCCAAAAACTTGGCCTCTGATAACCGGAAAGCCTTCATCATCTCCCCTACGCTACGTTTGCTGCGGGAAGCTGTT
TGCCTGGACGGCGGTGCTTACGCCAAGGCCATCGTTCGAGCTGGTACCTATACCTTTACCTCTCTGGCCCGGAAT
CTGGAGCTTGGAAGCTCAGGTCAAGGAACTGAGGATGCTGGCAAATCATCAATCAGGACGAATGCCGTCCATTTC
TTTCTGAGCTGCCTCAAACACGTCAGCTCACAGGGCCGAAAGGAGCTCCTTTCGCAGAGACACCTCTTCTCTCGA
CTGACGTACTTCATCAAAACCGATCCGCCACAAGTCGCCTTGGCAATACTGGACGCACTTCAGTCACATGTGCTC
ATGGATCCCAAGATACCGCGCGGTGTCAAGTTTCGCAACTTTAATACCAGGACACTGTTGAGACTACTAGCCCTT
TATGGTCTGCCGGGCGGCGACTCGGATGAGGGGAATCCTGTCAGTGACAGGGCTCACGACTTTCTCATGTACGCT
TGCACGTCACCCGGTGCTGGCATTCTCCTCCCTTACAGGGGCCTGTACCCGAAGGAGTCCAGCGACGAACAATCG
GACGACATAGCCGCCAGACAAGTCGAAAGCAAACCCGGAGACAGTCAGGCTGCTCATGAGAATCAGAGCCTCTGT
GTACATAATTTCGCCATGTCGGAATTCGCCGCCAAGCTCCGCCCGTGGGCCAGCACGAAACAGAGTCAACTTCTC
TTGGCCATGTTCACGGCCGCCCCAGAACTCATCGCTCACTACTTTCACGACAACCGATTCTTCACCTTTGAACCC
AAGGTGTCCATGACCTGGGTCGGGTACGCTGCCTTCCTCTTCGACACCATCAGCATCCCCCTGCGTCCTTCATTT
GGGGACTCTGTGCGGTATGCTGACGGCCCTCCTCCCGCGGCCGTTTTGCTGGATAACATCCTGCCTCCCGCCATC
ACTCAGAAAGTCCTCGTTCGATGTTTTTCGCCAAAGTCGGAGTCGGACGTGACGGCTCTTTTTGCCACAAAGATA
CTCGTCGCCGCTCTGGAGAAGCTTGTCACGACCCTCGAGATGCTGGATCCGGCGCAGGGTCGAAAGGAGGCCAAG
TGGTCGGAAACGGCCCGACGGCTCGAAGATGCCTTTTGTCAGCGGGTGCCCGAAATGAAGCAAATCGTCCTATGT
TACAAGGGGATTTCCAAAGAAAACTCAATGCACAGGACTTTGGCGAGCCGTCTTTTACTGCTCTACTACCGAGTA
ATCCCCCGCGTGGCTCTGGCCGCCAGCTTTGATGTCTCGCCCTTGCTCACGACTGTGCTGAAAGGGCTGCGGCAA
GACGGGCCAGAGCCTGGCGCCCGACAGCTCAGCCTCATTGAGTTGGAGGGTCTCGTGACGATAGCCAGTTACTCG
CCTGGCATGAGGTGGTTTTCCAGATCCGAAGGCCCGCGTCGTGAATTTTCAACCTCGGCGTTCGTCGCCCTGCTC
CAGCTTCTCTGTGGCGATGACGATCATACTCCCTTTCGTCACCTCAAAGAAGCGTTGGCTAGCGTTGCTGGGGAG
AGCCAACTCGTCTCAAAGTCGACAGGCTTGAAACCGCTGCTGGCGACCCTGCAACTCACTGTCACTCGGGTTGAC
ACGGGGGACATGGAATTGATATGGGCATTCTTGGATAATTGCACAGGCCGCTGCGTCGCCTCTCCGATCAAGTAC
ATCGAAATCTTGGAAACCCTATCGGCTGAGCGGACTGATAGTCCGGCGGCAGAGGAAGACGACGGATCACTGTCA
TTGCTCACCCTGGCACTTGTCGAGCAGCTGCCGTTTGCCGTGAAAACCGGCGACAAGAAGAGTATCAAGCCTCTC
GCGCGATTTCTCTCACTCTACTTCAATGCGTGCTATCTCTGGGAGGGTCAAGGCGAAGTCATCAAGGCTCTACAT
CAACAACTGCGCTGTACATTGTCAGAGATTAAAGTCAAGATGACTGCTTTGGGAGAAACCAGCGATGTGACAGCG
TTGAAAGCGACGGAGTCTGCTTCCGACAACAATCATGATCCCTCCCGCGTCACGGATGGACAACTGAAAAAGCCG
GGCGAGTTGGGTCTGCATCAACAGCTCCACGGGTCCCCCTTGGACGAAGGTGACGCGGCAGTCCTCGCAAAATGC
ATCTCGAAGACCTTGGAAGACGTGATAGAGGACGGATGGGTCGTCAAGTTGGGACGACTCTTGTTATCGGAGCAT
ACGCACATCCGCAAAGAGGCTCTCACCGGCATCCTCAAAGTCGCAGCTCGTGTCAAGGACTCGGCTCTCGAGGAA
CGCTCGCAGATCTGGCTGCTTCTTTCAGAGCTTGCCGAGTCGTCAAGGCCACAGATTGAGTCAGGCCCCGTCCCA
TCAGCTTTTGTGGCCTTCGTCATGCACGCCCTCGACGTGGTACAGAGTCCACTGCATCCGCTGTATCCAAAACTG
AATCGCTACCTCACCCGCAGCCCAATGTGGCCGCCGGACAAGCTGCCGCTCGCCCACGACATCCTCCACGGCGAG
CCGTCAGAGGACGACAAGTACTACATCGAGATCGCCTGGCTCCTGGACTATCTCCTCGATAGCCTGCGGACGCAG
CGTGACATGGACGTCTTCCACGGCAAGAAATGGCTCGAGAAGCTGCTCGCGCTCGGAAGCAACCCCTACCTCAGG
ACCGGGCTGCGAACCAGGCTCCTCAAGCTTGTCTACCGAGCAAGCTGCATACAAGGCGGCAGCACCACCCTCGTC
ACAAGGTTCGGCATCCTCAGCTGGCTACGTGGACAACGAGCGGCAGCCGACGCGGCCGACGAGGCTGCTGTTTGC
GAGCATCTGATGCGCCGCGTATGGGACACGTGTGACCGTCATCGCGTTTCTGCCTGGAGCCATGGCGGCGCGCAG
ACGCTCGTCCAAAGAGTGGCCTGCCAGCGAAGGGGCGCGCCGATCATATCGTCCACATTTTACGACGCTCAATCG
CAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail