Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04225
Gene name
Locationscaffold_04:1214699..1217753
Strand-
Gene length (bp)3054
Transcript length (bp)1890
Coding sequence length (bp)1890
Protein length (aa) 630

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 1.4E-13 403 445
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 8.5E-08 401 449
PF17123 zf-RING_11 RING-like zinc finger 7.0E-11 403 431
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 3.7E-08 403 444
PF12678 zf-rbx1 RING-H2 zinc finger domain 2.2E-07 407 445
PF14634 zf-RING_5 zinc-RING finger domain 1.2E-06 403 446
PF13445 zf-RING_UBOX RING-type zinc-finger 1.8E-06 404 442
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 7.0E-06 404 444

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5596 0.5765 0.2556 0.0692 0.4605 0.0558 0.3947 0.0736 0.2724 0.1129

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5677
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6236
Ophiocordyceps australis map64 (Brazil) OphauB2|7306
Ophiocordyceps camponoti-floridani Ophcf2|04225 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6628
Ophiocordyceps kimflemingae Ophio5|2389
Ophiocordyceps subramaniannii Hirsu2|831

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04225
MHVRCKRSSQVLIETYSRKTGKCPSSVTNIAFSRSPSLTSALRLCPSAARVCVRAPPRTCRFGFIFPSTACPLSR
LPSLAFRAIRAAGLAIGLGLTALNVYQRRQEEMASRGQRGGLLDATSDRSVVYCHACTNQWYRDGHDLRCPVCGS
DITEIVELHTDPRAPHDYHSPHSERPVHDEYDDDSDPDVADIDEFAGPHGFIHRRSIRTGRDEAGHHDPGVEPVL
HRFYEMLQTFSPVRATPGQENPPLRGEPGSPPWPRIQRTTFTSGPFGGGTASVTIFTGPSPARQQSAENPHDGVS
PDPYQAVLSHVLRDLTVPQGQNPTEQLHQATRSLQEILSLFNPANAMSGDAVYSQEALDRIITQLMDTNPQSNAA
PPASEEALRTLERKTVDREMLRGESKTECTICIEDMTVGDQAVVLPCKHWFHEDCVVLWLKEHNTCPICRTSIEA
DNANNSHNRGGGDHATRLTSRTESGTDSPGLPPRPSRGLRDHRDASERSGPPAANVSGAHAYSEGYRPLRLEAFR
ASHLGSQERGDRGQGREMPMRPVFHHGSRQWSSLSREGPDGTATEDRGARMPQRSPSGNVRGGQGGDGDSSRPTS
QGPISWLRERFTGGGSYSGNAPRGERRYH*
Coding >Ophcf2|04225
ATGCATGTTCGTTGCAAGCGTTCCTCACAGGTCCTGATCGAAACTTATTCGCGCAAGACTGGCAAGTGCCCTTCG
TCCGTCACAAACATAGCCTTTTCTCGATCGCCATCCCTGACCTCGGCTCTTCGTCTCTGTCCTTCCGCCGCTCGC
GTTTGTGTCCGAGCGCCTCCACGCACGTGCCGGTTCGGCTTCATTTTCCCATCTACTGCCTGCCCGCTTTCGAGG
TTGCCCAGTCTGGCGTTCCGCGCGATACGCGCTGCTGGCCTTGCCATAGGTCTCGGTTTGACAGCCTTGAACGTC
TATCAGCGCAGACAAGAAGAGATGGCTTCTCGCGGTCAACGCGGTGGGCTCCTCGACGCGACTAGCGACCGCTCT
GTCGTCTACTGCCACGCCTGTACCAATCAGTGGTATCGGGACGGGCATGACTTGCGCTGTCCAGTCTGCGGGAGC
GACATCACCGAAATTGTTGAGCTCCATACTGACCCTCGCGCGCCGCATGACTATCATTCACCTCATTCTGAAAGG
CCCGTCCATGACGAATACGATGACGATTCAGACCCCGACGTTGCCGATATCGACGAGTTCGCCGGACCGCATGGC
TTCATCCACCGCCGAAGCATCCGCACGGGTCGCGACGAAGCCGGACACCATGACCCGGGCGTCGAGCCTGTCCTT
CATCGCTTCTACGAAATGCTGCAGACCTTTAGCCCCGTCCGGGCGACTCCCGGTCAAGAAAATCCTCCACTGCGA
GGCGAGCCCGGCTCCCCGCCCTGGCCTCGAATTCAACGCACCACATTTACGTCTGGGCCGTTTGGTGGTGGAACC
GCCTCTGTCACCATCTTCACTGGCCCGTCGCCTGCCCGTCAGCAGAGTGCTGAAAATCCGCACGATGGCGTTTCC
CCTGATCCATATCAAGCAGTCCTCTCACACGTGCTGCGGGATCTGACGGTGCCGCAGGGTCAAAACCCGACGGAA
CAGCTTCATCAGGCCACCCGGAGCTTGCAGGAGATTTTGAGTCTCTTCAATCCGGCCAATGCCATGTCTGGCGAT
GCTGTTTACTCACAGGAGGCGCTCGATCGCATTATCACGCAGCTGATGGATACAAACCCCCAGTCCAACGCCGCG
CCTCCAGCCTCGGAGGAAGCCCTCAGGACCCTGGAGCGAAAGACGGTCGATCGGGAAATGCTCAGGGGCGAAAGC
AAGACGGAGTGCACCATCTGTATCGAAGACATGACCGTCGGTGATCAGGCCGTCGTTTTGCCTTGCAAGCACTGG
TTTCACGAGGATTGCGTCGTCTTGTGGCTGAAGGAGCACAACACTTGCCCGATTTGCAGGACGTCCATTGAGGCG
GACAACGCAAATAACAGCCACAACCGTGGCGGCGGCGACCATGCCACGCGCTTGACGTCGAGGACAGAATCCGGT
ACCGACTCCCCCGGTTTACCCCCAAGGCCGTCGAGAGGTTTGCGAGATCATAGGGATGCGTCCGAGAGGTCGGGC
CCTCCTGCGGCCAATGTCTCGGGCGCTCATGCGTACTCGGAAGGCTACCGTCCCCTGCGGCTCGAAGCCTTTCGA
GCCTCGCATCTCGGCTCGCAGGAGAGGGGCGACAGAGGACAGGGGCGAGAGATGCCGATGCGGCCCGTCTTTCAC
CACGGCTCGCGACAATGGTCGTCATTGTCCCGGGAAGGCCCCGACGGTACGGCGACGGAGGATCGCGGCGCTCGG
ATGCCGCAGAGGAGTCCGTCAGGCAACGTTAGAGGCGGACAAGGAGGCGATGGAGATTCAAGCAGGCCGACGAGC
CAGGGGCCCATTAGCTGGCTGAGGGAGCGCTTCACCGGCGGCGGATCCTACTCGGGCAATGCGCCCCGCGGTGAG
AGACGGTATCACTAG
Transcript >Ophcf2|04225
ATGCATGTTCGTTGCAAGCGTTCCTCACAGGTCCTGATCGAAACTTATTCGCGCAAGACTGGCAAGTGCCCTTCG
TCCGTCACAAACATAGCCTTTTCTCGATCGCCATCCCTGACCTCGGCTCTTCGTCTCTGTCCTTCCGCCGCTCGC
GTTTGTGTCCGAGCGCCTCCACGCACGTGCCGGTTCGGCTTCATTTTCCCATCTACTGCCTGCCCGCTTTCGAGG
TTGCCCAGTCTGGCGTTCCGCGCGATACGCGCTGCTGGCCTTGCCATAGGTCTCGGTTTGACAGCCTTGAACGTC
TATCAGCGCAGACAAGAAGAGATGGCTTCTCGCGGTCAACGCGGTGGGCTCCTCGACGCGACTAGCGACCGCTCT
GTCGTCTACTGCCACGCCTGTACCAATCAGTGGTATCGGGACGGGCATGACTTGCGCTGTCCAGTCTGCGGGAGC
GACATCACCGAAATTGTTGAGCTCCATACTGACCCTCGCGCGCCGCATGACTATCATTCACCTCATTCTGAAAGG
CCCGTCCATGACGAATACGATGACGATTCAGACCCCGACGTTGCCGATATCGACGAGTTCGCCGGACCGCATGGC
TTCATCCACCGCCGAAGCATCCGCACGGGTCGCGACGAAGCCGGACACCATGACCCGGGCGTCGAGCCTGTCCTT
CATCGCTTCTACGAAATGCTGCAGACCTTTAGCCCCGTCCGGGCGACTCCCGGTCAAGAAAATCCTCCACTGCGA
GGCGAGCCCGGCTCCCCGCCCTGGCCTCGAATTCAACGCACCACATTTACGTCTGGGCCGTTTGGTGGTGGAACC
GCCTCTGTCACCATCTTCACTGGCCCGTCGCCTGCCCGTCAGCAGAGTGCTGAAAATCCGCACGATGGCGTTTCC
CCTGATCCATATCAAGCAGTCCTCTCACACGTGCTGCGGGATCTGACGGTGCCGCAGGGTCAAAACCCGACGGAA
CAGCTTCATCAGGCCACCCGGAGCTTGCAGGAGATTTTGAGTCTCTTCAATCCGGCCAATGCCATGTCTGGCGAT
GCTGTTTACTCACAGGAGGCGCTCGATCGCATTATCACGCAGCTGATGGATACAAACCCCCAGTCCAACGCCGCG
CCTCCAGCCTCGGAGGAAGCCCTCAGGACCCTGGAGCGAAAGACGGTCGATCGGGAAATGCTCAGGGGCGAAAGC
AAGACGGAGTGCACCATCTGTATCGAAGACATGACCGTCGGTGATCAGGCCGTCGTTTTGCCTTGCAAGCACTGG
TTTCACGAGGATTGCGTCGTCTTGTGGCTGAAGGAGCACAACACTTGCCCGATTTGCAGGACGTCCATTGAGGCG
GACAACGCAAATAACAGCCACAACCGTGGCGGCGGCGACCATGCCACGCGCTTGACGTCGAGGACAGAATCCGGT
ACCGACTCCCCCGGTTTACCCCCAAGGCCGTCGAGAGGTTTGCGAGATCATAGGGATGCGTCCGAGAGGTCGGGC
CCTCCTGCGGCCAATGTCTCGGGCGCTCATGCGTACTCGGAAGGCTACCGTCCCCTGCGGCTCGAAGCCTTTCGA
GCCTCGCATCTCGGCTCGCAGGAGAGGGGCGACAGAGGACAGGGGCGAGAGATGCCGATGCGGCCCGTCTTTCAC
CACGGCTCGCGACAATGGTCGTCATTGTCCCGGGAAGGCCCCGACGGTACGGCGACGGAGGATCGCGGCGCTCGG
ATGCCGCAGAGGAGTCCGTCAGGCAACGTTAGAGGCGGACAAGGAGGCGATGGAGATTCAAGCAGGCCGACGAGC
CAGGGGCCCATTAGCTGGCTGAGGGAGCGCTTCACCGGCGGCGGATCCTACTCGGGCAATGCGCCCCGCGGTGAG
AGACGGTATCACTAG
Gene >Ophcf2|04225
ATGCATGTTCGTTGCAAGCGTTCCTCACAGGTCCTGATCGAAACTTATTCGCGCAAGACTGGCAAGTAACTTGGA
TGGTTCGGCGTGACCTTGAAGGACAAGCAGAGAGAGTTGGCGTCTGACAAACTTGGAGAGGAGACACGGCTGTCA
TTAATCATGGGAATCTAGTGCTCGACAGCGGTTGCAGCATGAGCAAGAAACCATACGATGGGCGGCATGAACGTG
ATTCCATGACCCAGGACGTTTGCTGCGGTGACTGCCACGTACGCGCTTCTTGACGGCACGGTCGGCTGAATATCT
TATTGTCCGCCTTAATATATGTCGCTGTTCGGTGAAGCGTCAGCCCGTCAGCAGTCCGCGCGTATGAGCCCGCTG
TCTCCGTCTTGACCCGAGGCACCATCACCCGGGTCCGGGTGCCCGCCTGCCAGGTCTGTACCTAGTCCGGCCTGA
AGCCACCGCCAGATACCTACCTACCTAGGTGCCTAGGTATCTACCTAGGTAGGTAGGCGGTAGTAGTAGACAAGG
AGGGGGAATACAAGTCATCATGGAAGCCGATATGTCGTAGGGCGTGGCAAGGCTGACCGTACCCTAGTGCTTATC
TAAGGTATAGAAGATTCTAGGCAACTTGCTTAATTTGACCTTATCTCGTGGTCAATTGAGTATCCACTGTTAGCA
GCTACTGGCAAGGCGCTTTAAGATACCTGTCAGCACGTGTTTCATTCTCGCAGCTGTTAGCGACTCTCGCTGATG
AATCACCCGCTACCAGGTAGGTACCTGCCTTTGTAGCTTCGCCGCCTTTATCTCGAGGTGCTAGCCCAAACTATC
CTTGAACCTCACTCAGGCTCTCCTCGACGTTCCTCGTCAACTTTCATTGCCGCGCACGCCACAAACCCCTATTCA
TCTGTGTTCTCGCCTGGTCTCTGTTTTTCGAGGCTTTCGTACCCGCGAGGGAGACGTGTTCCGCTTACCTACCTA
CCTACGAAGTACCTACAGTCAGTCGGGCTTAGGAGCGTGAGAGGTGCCCTTCGTCCGTCACAAACATAGGTACTC
TCGCATCCATCTCGTCGCTGCGTCATCATCACCGCCGTCACGCATACATTATCAATCAGAAACGGCCCGCTGACA
GCCCTCAGCCTTTTCTCGATCGCCATCCCTGACCTCGGCTCTTCGTCTCTGTCCTTCCGCCGCTCGCGTTTGTGT
CCGAGCGCCTCCACGCACGTGCCGGTTCGGCTTCATTTTCCCATCTACTGCCTGCCCGCTTTCGAGGTTGCCCAG
TCTGGCGTTCCGCGCGATACGCGCTGCTGGCCTTGCCATAGGTCTCGGTTTGACAGCCTTGAACGTCTATCAGCG
CAGACAAGAAGAGATGGCTTCTCGCGGTCAACGCGGTGGGCTCCTCGACGCGACTAGCGACCGCTCTGTCGTCTA
CTGCCACGCCTGTACCAATCAGTGGTATCGGGACGGGCATGACTTGCGCTGTCCAGTCTGCGGGAGCGACATCAC
CGAAATTGTACGTCGTCTTCGCTTTCCAAGACTTGATACCCTCTGACTCGGCTTTCTCGCAGGTTGAGCTCCATA
CTGACCCTCGCGCGCCGCATGACTATCATTCACCTCATTCTGAAAGGCCCGTCCATGACGAATACGATGACGATT
CAGACCCCGACGTTGCCGATATCGACGAGTTCGCCGGACCGCATGGCTTCATCCACCGCCGAAGCATCCGCACGG
GTCGCGACGAAGCCGGACACCATGACCCGGGCGTCGAGCCTGTCCTTCATCGCTTCTACGAAATGCTGCAGACCT
TTAGCCCCGTCCGGGCGACTCCCGGTCAAGAAAATCCTCCACTGCGAGGCGAGCCCGGCTCCCCGCCCTGGCCTC
GAATTCAACGCACCACATTTACGTCTGGGCCGTTTGGTGGTGGAACCGCCTCTGTCACCATCTTCACTGGCCCGT
CGCCTGCCCGTCAGCAGAGTGCTGAAAATCCGCACGATGGCGTTTCCCCTGATCCATATCAAGCGTAAGCCTTAA
CTCTCTATCAATGCCACTCCGTCCATGTTGGCCAGTGCAGCTGACTTGAACGGCAGAGTCCTCTCACACGTGCTG
CGGGATCTGACGGTGCCGCAGGGTCAAAACCCGACGGAACAGCTTCATCAGGCCACCCGGAGCTTGCAGGAGATT
TTGAGTCTCTTCAATCCGGCCAATGCCATGTCTGGCGATGCTGTTTACTCACAGGAGGCGCTCGATCGCATTATC
ACGCAGCTGATGGATACAAACCCCCAGTCCAACGCCGCGCCTCCAGCCTCGGAGGAAGCCCTCAGGACCCTGGAG
CGAAAGACGGTCGATCGGGAAATGCTCAGGGGCGAAAGCAAGACGGAGTGCACCATCTGTATCGAAGACATGACC
GTCGGTGATCAGGCCGTCGTTTTGCCTTGCAAGCACTGGTTTCACGAGGATTGCGTCGTCTTGTGGCTGAAGGAG
CACAACACTTGCCCGATTTGCAGGACGTCCATTGAGGCGGACAACGCAAATAACAGCCACAACCGTGGCGGCGGC
GACCATGCCACGCGCTTGACGTCGAGGACAGAATCCGGTACCGACTCCCCCGGTTTACCCCCAAGGCCGTCGAGA
GGTTTGCGAGATCATAGGGATGCGTCCGAGAGGTCGGGCCCTCCTGCGGCCAATGTCTCGGGCGCTCATGCGTAC
TCGGAAGGCTACCGTCCCCTGCGGCTCGAAGCCTTTCGAGCCTCGCATCTCGGCTCGCAGGAGAGGGGCGACAGA
GGACAGGGGCGAGAGATGCCGATGCGGCCCGTCTTTCACCACGGCTCGCGACAATGGTCGTCATTGTCCCGGGAA
GGCCCCGACGGTACGGCGACGGAGGATCGCGGCGCTCGGATGCCGCAGAGGAGTCCGTCAGGCAACGTTAGAGGC
GGACAAGGAGGCGATGGAGATTCAAGCAGGCCGACGAGCCAGGGGCCCATTAGCTGGCTGAGGGAGCGCTTCACC
GGCGGCGGATCCTACTCGGGCAATGCGCCCCGCGGTGAGAGACGGTATCACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail