Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04221
Gene name
Locationscaffold_04:1203560..1204370
Strand+
Gene length (bp)810
Transcript length (bp)621
Coding sequence length (bp)621
Protein length (aa) 207

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08718 GLTP Glycolipid transfer protein (GLTP) 7.1E-48 33 171

GO

GO Term Description Terminal node
GO:0120013 lipid transfer activity Yes
GO:0005737 cytoplasm Yes
GO:0120009 intermembrane lipid transfer Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0051234 establishment of localization No
GO:0005319 lipid transporter activity No
GO:0016043 cellular component organization No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0061024 membrane organization No
GO:0008150 biological_process No
GO:0006869 lipid transport No
GO:0071702 organic substance transport No
GO:0051179 localization No
GO:0071840 cellular component organization or biogenesis No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7418 0.3378 0.2665 0.252 0.1016 0.0125 0.0587 0.4149 0.3168 0.0197

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5808
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|804
Ophiocordyceps australis map64 (Brazil) OphauB2|7302
Ophiocordyceps camponoti-floridani Ophcf2|04221 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6631
Ophiocordyceps kimflemingae Ophio5|2385
Ophiocordyceps subramaniannii Hirsu2|997

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04221
MSTPVIPAGGTIVQSFKKSFVDVPIDADKDKAIATTPFLEAAESLTTIFDVLGSVAFSPVKSDMMGNIKKVRDRQ
LAAPAESENVQDLCRNEIKEKKHTATEGLLWLIRGLDFTCIALSQNLSKPSEELADSFRGAYGETLKPHHSFIVK
PLFSAAMSACPYRKDFYSKLGTDQTKVNDDLRVYLASLEKIVGILKDFLDTKEAKW*
Coding >Ophcf2|04221
ATGTCCACTCCTGTTATCCCTGCCGGCGGCACGATTGTGCAGTCGTTCAAGAAGTCCTTCGTCGACGTGCCAATC
GACGCGGACAAGGACAAAGCCATCGCCACGACGCCCTTCCTCGAGGCCGCCGAGTCCTTGACCACCATCTTCGAT
GTCCTCGGATCTGTTGCCTTCTCCCCCGTCAAGTCGGATATGATGGGCAACATTAAGAAAGTCCGCGACCGACAG
CTCGCCGCCCCCGCTGAGTCCGAGAACGTCCAAGATCTTTGCCGCAACGAGATCAAGGAGAAGAAGCACACTGCC
ACCGAAGGTCTTCTGTGGCTGATCCGGGGGCTCGATTTCACGTGCATTGCCCTGAGCCAGAACCTTTCCAAACCG
TCGGAGGAGCTCGCCGACTCATTCCGGGGCGCATATGGCGAAACGCTCAAGCCCCACCACAGCTTCATCGTGAAG
CCCCTCTTCAGCGCTGCCATGAGCGCCTGCCCCTATCGCAAGGACTTTTACAGCAAACTGGGAACCGACCAGACC
AAAGTGAATGATGATTTGCGCGTCTACCTTGCTTCTCTGGAAAAGATTGTCGGCATTCTCAAGGACTTCCTCGAC
ACTAAGGAGGCCAAGTGGTGA
Transcript >Ophcf2|04221
ATGTCCACTCCTGTTATCCCTGCCGGCGGCACGATTGTGCAGTCGTTCAAGAAGTCCTTCGTCGACGTGCCAATC
GACGCGGACAAGGACAAAGCCATCGCCACGACGCCCTTCCTCGAGGCCGCCGAGTCCTTGACCACCATCTTCGAT
GTCCTCGGATCTGTTGCCTTCTCCCCCGTCAAGTCGGATATGATGGGCAACATTAAGAAAGTCCGCGACCGACAG
CTCGCCGCCCCCGCTGAGTCCGAGAACGTCCAAGATCTTTGCCGCAACGAGATCAAGGAGAAGAAGCACACTGCC
ACCGAAGGTCTTCTGTGGCTGATCCGGGGGCTCGATTTCACGTGCATTGCCCTGAGCCAGAACCTTTCCAAACCG
TCGGAGGAGCTCGCCGACTCATTCCGGGGCGCATATGGCGAAACGCTCAAGCCCCACCACAGCTTCATCGTGAAG
CCCCTCTTCAGCGCTGCCATGAGCGCCTGCCCCTATCGCAAGGACTTTTACAGCAAACTGGGAACCGACCAGACC
AAAGTGAATGATGATTTGCGCGTCTACCTTGCTTCTCTGGAAAAGATTGTCGGCATTCTCAAGGACTTCCTCGAC
ACTAAGGAGGCCAAGTGGTGA
Gene >Ophcf2|04221
ATGTCCACTCCTGTTATCCCTGCCGGCGGCACGATTGTGCAGTCGTTCAAGAAGTCCTTCGTCGACGTGCCAATC
GACGCGGACAAGGACAAAGCCATCGCCACGACGCCCTTCCTCGAGGCCGCCGAGTCCTTGACCACCATCTTCGGT
CTGCCTGAGCGCCTCATTACGTTTTGCGATTTTGACTGACGAGCGTATGTGTAGATGTCCTCGGATCTGTTGCCT
TCTCCCCCGTCAAGTCGGATATGATGGGCAACATTAAGGTCCGCCCCCGCTCCCTCGTCTTCTCGCCTCCCCGAC
CATCGTGCTGACCTGGCCCTTTATAAAGAAAGTCCGCGACCGACAGCTCGCCGCCCCCGCTGAGTCCGAGAACGT
CCAAGATCTTTGCCGCAACGAGATCAAGGAGAAGAAGCACACTGCCACCGAAGGTCTTCTGTGGCTGATCCGGTT
CGTCCACCCAGCTGTCACCCTTTAACCCTTATCGACCGTATTGAGCTCACTGACGTGTTGCACAGGGGGCTCGAT
TTCACGTGCATTGCCCTGAGCCAGAACCTTTCCAAACCGTCGGAGGAGCTCGCCGACTCATTCCGGGGCGCATAT
GGCGAAACGCTCAAGCCCCACCACAGCTTCATCGTGAAGCCCCTCTTCAGCGCTGCCATGAGCGCCTGCCCCTAT
CGCAAGGACTTTTACAGCAAACTGGGAACCGACCAGACCAAAGTGAATGATGATTTGCGCGTCTACCTTGCTTCT
CTGGAAAAGATTGTCGGCATTCTCAAGGACTTCCTCGACACTAAGGAGGCCAAGTGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail