Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04220
Gene name
Locationscaffold_04:1199510..1202286
Strand-
Gene length (bp)2776
Transcript length (bp)2547
Coding sequence length (bp)2547
Protein length (aa) 849

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00614 PLDc Phospholipase D Active site motif 1.4E-07 208 233
PF00614 PLDc Phospholipase D Active site motif 1.4E-04 637 660

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6436 0.2874 0.0977 0.1821 0.26 0.0537 0.5114 0.3219 0.1709 0.0928

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5114
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|805
Ophiocordyceps australis map64 (Brazil) OphauB2|7301
Ophiocordyceps camponoti-floridani Ophcf2|04220 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6632
Ophiocordyceps kimflemingae Ophio5|2384
Ophiocordyceps subramaniannii Hirsu2|3314

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04220
MSESKDDQGSFSSFVDDLKDKLHDSKLHDAKVHLIHKKHQIGKLGNLFNRDHRHDEDHEQRCDEKRSKTCETHRY
ESFFPERDGNLVKWYVDGRDYFWAVSVALEEAQETIYIADWWLSPELFLRRPPYHKQEHRLDQILKRRAEAGVKI
YIIVYKEVEAALTCNSRHTKNALQALCPEGTPGHGNIRVVRHPDHNVFENAADMTMYWAHHEKFIVIDYYLAFIG
GLDLCFGRWDARQHPLSDVHPEGVSEEIWPGQDFNNNRIMDFKKVEDWQQNELSKAEFGRMPWHDVAMALIGPCV
YDIAEHFVLRWNFIKRDKHKRDERHDWLVLEGREGDDEDLVGVQRPKHPVGEYVKHPLTPLASKNLENRGTIHAQ
VVRSSADWSSGILNDHSIQNAYCEVIRKAEHYVYIENQFFITATGDQQSPIHNNIGAAMVDAVVRAAKEGRKFRI
IVIIPAIPGFAGDLRENAASGTRAIMDYQYKSICRGEHSIFGRIKAQGVDPNQHIFFFNLRSYDRLNKTNAITVA
EKKTGISYQQVQRAEAEEIMAEGVYGYEDDSSDDGRRSKRDEKTNAQRGPSENVIKARKVFDEAKPDEEVVSAAS
VAHHALAGQGSLKDEPWDTHADPESEIRNWIQEELYVHAKLVIADDRVVICGSSNINDRSQLGDHDSELSIVMED
TRMVPSTMDGQPFEVGWHAATLRRFLWREHLGLLPPQDLDAAEDINAQPPTVNPENNVYDDIDSYKFVEDPLSDD
LWSMWTGQADKNTGLFRHLFHADPDDKIKTFEDYDRYLPPKGVKSGHIYDQFMPPEEAREKLDQIKGHLVWMPMT
FLEDAEMAEWGLQVNAWTESVYT*
Coding >Ophcf2|04220
ATGTCGGAGTCAAAGGACGATCAGGGCAGCTTCTCGTCCTTCGTCGACGACCTCAAGGACAAGCTGCATGATAGC
AAGCTTCATGACGCAAAGGTCCATCTCATTCATAAAAAGCACCAGATTGGAAAATTGGGCAACCTTTTCAACAGA
GACCATCGCCACGATGAAGACCACGAGCAGAGATGCGACGAAAAGAGGTCCAAGACATGCGAAACCCACCGCTAC
GAGTCATTTTTCCCCGAACGAGACGGTAATCTCGTCAAGTGGTACGTCGACGGTCGCGACTACTTCTGGGCCGTT
TCGGTGGCCCTAGAAGAGGCTCAAGAGACCATATACATTGCCGACTGGTGGCTATCACCCGAGCTCTTTCTCCGA
CGTCCGCCGTATCACAAGCAGGAGCACCGTCTTGATCAGATTCTCAAGCGGCGAGCAGAAGCGGGCGTCAAAATC
TATATCATCGTTTACAAGGAAGTCGAGGCCGCTTTAACCTGCAACTCTCGCCACACCAAGAATGCGCTCCAGGCC
CTTTGTCCCGAGGGCACGCCAGGTCACGGCAACATCCGCGTGGTGCGACATCCGGACCACAACGTCTTCGAGAAC
GCTGCCGACATGACCATGTACTGGGCCCATCACGAAAAGTTCATCGTCATCGACTACTACCTGGCCTTCATCGGC
GGGCTTGATCTCTGCTTTGGCCGCTGGGACGCTCGGCAGCACCCTCTTTCCGATGTTCATCCCGAGGGCGTCTCG
GAGGAGATATGGCCAGGCCAGGATTTCAACAACAACCGTATCATGGACTTCAAAAAGGTCGAGGATTGGCAGCAG
AACGAACTTAGCAAGGCCGAGTTCGGCCGCATGCCATGGCACGACGTAGCCATGGCGCTCATTGGCCCCTGCGTC
TACGACATCGCCGAGCACTTCGTCCTGCGTTGGAACTTTATCAAGCGGGACAAGCACAAGCGCGACGAGCGCCAT
GACTGGCTGGTCCTCGAGGGCCGCGAAGGAGACGACGAGGACCTGGTCGGCGTTCAGCGGCCCAAACACCCCGTC
GGAGAATACGTCAAGCATCCCTTGACGCCTCTCGCCTCCAAGAACCTCGAGAACCGGGGCACGATCCACGCCCAA
GTCGTTCGCTCGAGCGCCGACTGGTCCAGCGGGATACTCAATGATCATTCCATTCAAAACGCCTACTGCGAGGTC
ATCCGAAAAGCAGAGCACTACGTCTATATCGAGAATCAGTTCTTCATCACTGCCACGGGCGACCAGCAGTCTCCC
ATTCACAACAACATAGGCGCGGCCATGGTGGATGCCGTTGTGCGAGCGGCTAAGGAGGGCCGCAAGTTTCGTATC
ATCGTCATCATCCCGGCGATCCCGGGCTTCGCTGGTGACCTGCGGGAGAACGCGGCTTCGGGCACTCGAGCCATC
ATGGACTATCAATACAAGTCGATATGTCGCGGCGAGCACTCCATCTTCGGCCGCATCAAGGCTCAGGGCGTCGAC
CCGAATCAGCACATCTTCTTCTTCAATCTTCGTTCCTACGACCGGCTCAACAAGACGAATGCCATTACTGTAGCG
GAGAAGAAGACCGGGATCAGCTACCAACAGGTGCAACGAGCTGAGGCGGAGGAGATCATGGCTGAGGGCGTTTAC
GGGTACGAAGACGATAGTTCCGATGATGGCAGGCGGTCGAAGCGCGACGAAAAGACCAACGCACAAAGAGGACCA
TCGGAGAACGTGATCAAGGCGAGAAAGGTATTCGACGAGGCAAAGCCTGATGAGGAAGTAGTATCGGCCGCATCC
GTTGCCCACCACGCTCTGGCCGGTCAGGGCTCTCTCAAGGACGAGCCATGGGATACCCACGCGGACCCAGAGTCT
GAGATACGGAATTGGATCCAAGAAGAGCTCTACGTCCACGCCAAGCTTGTCATTGCAGACGATCGGGTCGTCATC
TGCGGTTCAAGCAATATCAACGACCGCAGCCAGCTAGGAGACCACGACAGCGAGCTTAGCATCGTCATGGAGGAT
ACAAGAATGGTTCCAAGCACAATGGATGGACAGCCGTTTGAGGTCGGCTGGCATGCTGCCACCTTGCGCCGCTTC
CTGTGGCGAGAGCATCTGGGCCTCCTTCCGCCGCAGGATCTGGATGCCGCCGAGGACATCAATGCCCAGCCTCCC
ACGGTAAATCCGGAAAACAACGTATACGACGACATCGATAGCTACAAGTTTGTCGAGGATCCCTTGAGTGACGAT
CTGTGGTCCATGTGGACCGGACAGGCAGACAAAAACACGGGCTTGTTTCGGCACCTGTTCCACGCGGACCCGGAC
GACAAGATCAAAACGTTTGAGGACTACGACCGCTATCTCCCACCCAAGGGCGTCAAGTCGGGTCACATCTACGAT
CAGTTCATGCCACCCGAAGAGGCAAGGGAGAAGCTCGATCAGATCAAGGGACACTTGGTGTGGATGCCCATGACG
TTTCTGGAAGACGCTGAAATGGCGGAATGGGGATTGCAGGTCAACGCGTGGACGGAAAGCGTGTATACCTAG
Transcript >Ophcf2|04220
ATGTCGGAGTCAAAGGACGATCAGGGCAGCTTCTCGTCCTTCGTCGACGACCTCAAGGACAAGCTGCATGATAGC
AAGCTTCATGACGCAAAGGTCCATCTCATTCATAAAAAGCACCAGATTGGAAAATTGGGCAACCTTTTCAACAGA
GACCATCGCCACGATGAAGACCACGAGCAGAGATGCGACGAAAAGAGGTCCAAGACATGCGAAACCCACCGCTAC
GAGTCATTTTTCCCCGAACGAGACGGTAATCTCGTCAAGTGGTACGTCGACGGTCGCGACTACTTCTGGGCCGTT
TCGGTGGCCCTAGAAGAGGCTCAAGAGACCATATACATTGCCGACTGGTGGCTATCACCCGAGCTCTTTCTCCGA
CGTCCGCCGTATCACAAGCAGGAGCACCGTCTTGATCAGATTCTCAAGCGGCGAGCAGAAGCGGGCGTCAAAATC
TATATCATCGTTTACAAGGAAGTCGAGGCCGCTTTAACCTGCAACTCTCGCCACACCAAGAATGCGCTCCAGGCC
CTTTGTCCCGAGGGCACGCCAGGTCACGGCAACATCCGCGTGGTGCGACATCCGGACCACAACGTCTTCGAGAAC
GCTGCCGACATGACCATGTACTGGGCCCATCACGAAAAGTTCATCGTCATCGACTACTACCTGGCCTTCATCGGC
GGGCTTGATCTCTGCTTTGGCCGCTGGGACGCTCGGCAGCACCCTCTTTCCGATGTTCATCCCGAGGGCGTCTCG
GAGGAGATATGGCCAGGCCAGGATTTCAACAACAACCGTATCATGGACTTCAAAAAGGTCGAGGATTGGCAGCAG
AACGAACTTAGCAAGGCCGAGTTCGGCCGCATGCCATGGCACGACGTAGCCATGGCGCTCATTGGCCCCTGCGTC
TACGACATCGCCGAGCACTTCGTCCTGCGTTGGAACTTTATCAAGCGGGACAAGCACAAGCGCGACGAGCGCCAT
GACTGGCTGGTCCTCGAGGGCCGCGAAGGAGACGACGAGGACCTGGTCGGCGTTCAGCGGCCCAAACACCCCGTC
GGAGAATACGTCAAGCATCCCTTGACGCCTCTCGCCTCCAAGAACCTCGAGAACCGGGGCACGATCCACGCCCAA
GTCGTTCGCTCGAGCGCCGACTGGTCCAGCGGGATACTCAATGATCATTCCATTCAAAACGCCTACTGCGAGGTC
ATCCGAAAAGCAGAGCACTACGTCTATATCGAGAATCAGTTCTTCATCACTGCCACGGGCGACCAGCAGTCTCCC
ATTCACAACAACATAGGCGCGGCCATGGTGGATGCCGTTGTGCGAGCGGCTAAGGAGGGCCGCAAGTTTCGTATC
ATCGTCATCATCCCGGCGATCCCGGGCTTCGCTGGTGACCTGCGGGAGAACGCGGCTTCGGGCACTCGAGCCATC
ATGGACTATCAATACAAGTCGATATGTCGCGGCGAGCACTCCATCTTCGGCCGCATCAAGGCTCAGGGCGTCGAC
CCGAATCAGCACATCTTCTTCTTCAATCTTCGTTCCTACGACCGGCTCAACAAGACGAATGCCATTACTGTAGCG
GAGAAGAAGACCGGGATCAGCTACCAACAGGTGCAACGAGCTGAGGCGGAGGAGATCATGGCTGAGGGCGTTTAC
GGGTACGAAGACGATAGTTCCGATGATGGCAGGCGGTCGAAGCGCGACGAAAAGACCAACGCACAAAGAGGACCA
TCGGAGAACGTGATCAAGGCGAGAAAGGTATTCGACGAGGCAAAGCCTGATGAGGAAGTAGTATCGGCCGCATCC
GTTGCCCACCACGCTCTGGCCGGTCAGGGCTCTCTCAAGGACGAGCCATGGGATACCCACGCGGACCCAGAGTCT
GAGATACGGAATTGGATCCAAGAAGAGCTCTACGTCCACGCCAAGCTTGTCATTGCAGACGATCGGGTCGTCATC
TGCGGTTCAAGCAATATCAACGACCGCAGCCAGCTAGGAGACCACGACAGCGAGCTTAGCATCGTCATGGAGGAT
ACAAGAATGGTTCCAAGCACAATGGATGGACAGCCGTTTGAGGTCGGCTGGCATGCTGCCACCTTGCGCCGCTTC
CTGTGGCGAGAGCATCTGGGCCTCCTTCCGCCGCAGGATCTGGATGCCGCCGAGGACATCAATGCCCAGCCTCCC
ACGGTAAATCCGGAAAACAACGTATACGACGACATCGATAGCTACAAGTTTGTCGAGGATCCCTTGAGTGACGAT
CTGTGGTCCATGTGGACCGGACAGGCAGACAAAAACACGGGCTTGTTTCGGCACCTGTTCCACGCGGACCCGGAC
GACAAGATCAAAACGTTTGAGGACTACGACCGCTATCTCCCACCCAAGGGCGTCAAGTCGGGTCACATCTACGAT
CAGTTCATGCCACCCGAAGAGGCAAGGGAGAAGCTCGATCAGATCAAGGGACACTTGGTGTGGATGCCCATGACG
TTTCTGGAAGACGCTGAAATGGCGGAATGGGGATTGCAGGTCAACGCGTGGACGGAAAGCGTGTATACCTAG
Gene >Ophcf2|04220
ATGTCGGAGTCAAAGGACGATCAGGGCAGCTTCTCGTCCTTCGTCGACGACCTCAAGGACAAGCTGCATGATAGC
AAGCTTCATGACGCAAAGGTCCATCTCATTCATAAAAAGTTCGTGCTTCTCTTCGCCTCTCGCCCAGGTCCAGTT
ACGGATATTCGCTGACGTCGCAACTCTTTGTTCAGGCACCAGATTGGAAAATTGGGCAACCTTGTAAGTGGCTTA
TTACTGTCCGTTCATTGTTGCCCACACGTCACGCGTCGTGTGCTTCGTCGTGTACCATCCTCGCCTGACCAAGAC
CATCGCAGTTCAACAGAGACCATCGCCACGATGAAGACCACGAGCAGAGATGCGACGAAAAGAGGTCCAAGACAT
GCGAAACCCACCGCTACGAGTCATTTTTCCCCGAACGAGACGGTAATCTCGTCAAGTGGTACGTCGACGGTCGCG
ACTACTTCTGGGCCGTTTCGGTGGCCCTAGAAGAGGCTCAAGAGACCATATACATTGCCGACTGGTGGCTATCAC
CCGAGCTCTTTCTCCGACGTCCGCCGTATCACAAGCAGGAGCACCGTCTTGATCAGATTCTCAAGCGGCGAGCAG
AAGCGGGCGTCAAAATCTATATCATCGTTTACAAGGAAGTCGAGGCCGCTTTAACCTGCAACTCTCGCCACACCA
AGAATGCGCTCCAGGCCCTTTGTCCCGAGGGCACGCCAGGTCACGGCAACATCCGCGTGGTGCGACATCCGGACC
ACAACGTCTTCGAGAACGCTGCCGACATGACCATGTACTGGGCCCATCACGAAAAGTTCATCGTCATCGACTACT
ACCTGGCCTTCATCGGCGGGCTTGATCTCTGCTTTGGCCGCTGGGACGCTCGGCAGCACCCTCTTTCCGATGTTC
ATCCCGAGGGCGTCTCGGAGGAGATATGGCCAGGCCAGGATTTCAACAACAACCGTATCATGGACTTCAAAAAGG
TCGAGGATTGGCAGCAGAACGAACTTAGCAAGGCCGAGTTCGGCCGCATGCCATGGCACGACGTAGCCATGGCGC
TCATTGGCCCCTGCGTCTACGACATCGCCGAGCACTTCGTCCTGCGTTGGAACTTTATCAAGCGGGACAAGCACA
AGCGCGACGAGCGCCATGACTGGCTGGTCCTCGAGGGCCGCGAAGGAGACGACGAGGACCTGGTCGGCGTTCAGC
GGCCCAAACACCCCGTCGGAGAATACGTCAAGCATCCCTTGACGCCTCTCGCCTCCAAGAACCTCGAGAACCGGG
GCACGATCCACGCCCAAGTCGTTCGCTCGAGCGCCGACTGGTCCAGCGGGATACTCAATGATCATTCCATTCAAA
ACGCCTACTGCGAGGTCATCCGAAAAGCAGAGCACTACGTCTATATCGAGAATCAGTTCTTCATCACTGCCACGG
GCGACCAGCAGTCTCCCATTCACAACAACATAGGCGCGGCCATGGTGGATGCCGTTGTGCGAGCGGCTAAGGAGG
GCCGCAAGTTTCGTATCATCGTCATCATCCCGGCGATCCCGGGCTTCGCTGGTGACCTGCGGGAGAACGCGGCTT
CGGGCACTCGAGCCATCATGGACTATCAATACAAGTCGATATGTCGCGGCGAGCACTCCATCTTCGGCCGCATCA
AGGCTCAGGGCGTCGACCCGAATCAGCACATCTTCTTCTTCAATCTTCGTTCCTACGACCGGCTCAACAAGACGA
ATGCCATTACTGTAGCGGAGAAGAAGACCGGGATCAGCTACCAACAGGTGCAACGAGCTGAGGCGGAGGAGATCA
TGGCTGAGGGCGTTTACGGGTACGAAGACGATAGTTCCGATGATGGCAGGCGGTCGAAGCGCGACGAAAAGACCA
ACGCACAAAGAGGACCATCGGAGAACGTGATCAAGGCGAGAAAGGTATTCGACGAGGCAAAGCCTGATGAGGAAG
TAGTATCGGCCGCATCCGTTGCCCACCACGCTCTGGCCGGTCAGGGCTCTCTCAAGGACGAGCCATGGGATACCC
ACGCGGACCCAGAGTCTGAGATACGGAATTGGATCCAAGAAGAGCTCTACGTCCACGCCAAGCTTGTCATTGCAG
ACGATCGGGTCGTCATCTGCGGTTCAAGCAATATCAACGACCGCAGCCAGCTAGGAGACCACGACAGCGAGCTTA
GCATCGTCATGGAGGATACAAGAATGGTTCCAAGCACAATGGATGGACAGCCGTTTGAGGTCGGCTGGCATGCTG
CCACCTTGCGCCGCTTCCTGTGGCGAGAGCATCTGGGCCTCCTTCCGCCGCAGGATCTGGATGCCGCCGAGGACA
TCAATGCCCAGCCTCCCACGGTAAATCCGGAAAACAACGTATACGACGACATCGATAGCTACAAGTTTGTCGAGG
ATCCCTTGAGTGACGATCTGTGGTCCATGTGGACCGGACAGGCAGACAAAAACACGGGCTTGTTTCGGCACCTGT
TCCACGCGGACCCGGACGACAAGAGTAAGTTCAAATACCGTGTCCTGAAGATACTCTCCGTGAAGGCGCGCGCTG
ATTAGGAGCAGTCAAAACGTTTGAGGACTACGACCGCTATCTCCCACCCAAGGGCGTCAAGTCGGGTCACATCTA
CGATCAGTTCATGCCACCCGAAGAGGCAAGGGAGAAGCTCGATCAGATCAAGGGACACTTGGTGTGGATGCCCAT
GACGTTTCTGGAAGACGCTGAAATGGCGGAATGGGGATTGCAGGTCAACGCGTGGACGGAAAGCGTGTATACCTA
G

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail