Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04203
Gene name
Locationscaffold_04:1135613..1136264
Strand+
Gene length (bp)651
Transcript length (bp)462
Coding sequence length (bp)462
Protein length (aa) 154

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14853 Fis1_TPR_C Fis1 C-terminal tetratricopeptide repeat 1.4E-25 74 126
PF14852 Fis1_TPR_N Fis1 N-terminal tetratricopeptide repeat 1.1E-16 37 67

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 125 147 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 261.26 147.60 374.93
Alive In ants, during behavior modification 310.90 177.68 444.11
Dead In ants, recently dead 316.29 181.04 451.54

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.389363 no
Alive Dead 0.934082 no
Dead Fungus 0.335874 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04203
MVAELPYALDAETPLNPSELNVLRAQYEKEGEMVGVQTKFNYAWGLVKSNARSDQQLGVRLLSDIFRLSPERRRE
CLYYLALGNYKLGNYSEARRYNDLLLDKEPANLQASDLRQLIDNRVAKEGLMGVAIVSGISIAAGVLGAFVFRNA
RRR*
Coding >Ophcf2|04203
ATGGTCGCAGAACTACCTTACGCCCTCGACGCAGAGACGCCTCTGAACCCATCCGAACTCAACGTCCTGCGTGCG
CAATACGAAAAGGAGGGCGAAATGGTCGGCGTACAGACAAAATTCAATTACGCCTGGGGCCTAGTAAAATCAAAC
GCCCGTTCCGACCAACAGCTCGGCGTCCGTCTCCTCTCCGACATCTTCCGCCTTTCTCCCGAGCGCCGCCGTGAA
TGTCTCTACTACCTCGCACTAGGGAACTACAAGCTCGGAAACTACAGCGAAGCACGCCGCTACAACGATCTCCTC
CTCGACAAGGAGCCCGCCAATCTACAGGCCTCGGACCTTCGCCAGCTGATTGACAACAGAGTCGCCAAGGAAGGC
CTCATGGGCGTCGCCATTGTCAGTGGTATCAGCATTGCTGCCGGAGTTCTCGGAGCCTTTGTCTTCAGAAACGCC
CGTCGGAGATGA
Transcript >Ophcf2|04203
ATGGTCGCAGAACTACCTTACGCCCTCGACGCAGAGACGCCTCTGAACCCATCCGAACTCAACGTCCTGCGTGCG
CAATACGAAAAGGAGGGCGAAATGGTCGGCGTACAGACAAAATTCAATTACGCCTGGGGCCTAGTAAAATCAAAC
GCCCGTTCCGACCAACAGCTCGGCGTCCGTCTCCTCTCCGACATCTTCCGCCTTTCTCCCGAGCGCCGCCGTGAA
TGTCTCTACTACCTCGCACTAGGGAACTACAAGCTCGGAAACTACAGCGAAGCACGCCGCTACAACGATCTCCTC
CTCGACAAGGAGCCCGCCAATCTACAGGCCTCGGACCTTCGCCAGCTGATTGACAACAGAGTCGCCAAGGAAGGC
CTCATGGGCGTCGCCATTGTCAGTGGTATCAGCATTGCTGCCGGAGTTCTCGGAGCCTTTGTCTTCAGAAACGCC
CGTCGGAGATGA
Gene >Ophcf2|04203
ATGGTCGCAGAACTACCTTGTGAGCCGATCCTCACTCTCCCTCCGGCCATATTCGCTAACCAAGTCCACCGCTTA
CAGACGCCCTCGACGCAGAGACGTTCGTGTTCCTCCCCGTCTCTCCGCGATGCGTACGCTTTTGACTAACATGCC
AGACAACAGGCCTCTGAACCCATCCGAACTCAACGTCCTGCGTGCGCAATACGAAAAGGAGGGCGAAATGGTCGG
CGTACAGACAAAATTCAATTACGCCTGGGTACGTCTCTTCCCCATCCTTTCCCTCGTCAGCCATAATCATACTTA
CCCTCTCACCTTCTCGTACAGGGCCTAGTAAAATCAAACGCCCGTTCCGACCAACAGCTCGGCGTCCGTCTCCTC
TCCGACATCTTCCGCCTTTCTCCCGAGCGCCGCCGTGAATGTCTCTACTACCTCGCACTAGGGAACTACAAGCTC
GGAAACTACAGCGAAGCACGCCGCTACAACGATCTCCTCCTCGACAAGGAGCCCGCCAATCTACAGGCCTCGGAC
CTTCGCCAGCTGATTGACAACAGAGTCGCCAAGGAAGGCCTCATGGGCGTCGCCATTGTCAGTGGTATCAGCATT
GCTGCCGGAGTTCTCGGAGCCTTTGTCTTCAGAAACGCCCGTCGGAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail