Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04194
Gene name
Locationscaffold_04:1117354..1118423
Strand-
Gene length (bp)1069
Transcript length (bp)729
Coding sequence length (bp)729
Protein length (aa) 243

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14580 LRR_9 Leucine-rich repeat 2.9E-53 2 167
PF13855 LRR_8 Leucine rich repeat 2.9E-08 62 122

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.6128 0.6923 0.0147 0.0721 0.07 0.0016 0.1417 0.1014 0.0647 0.0032

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3734
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4973
Ophiocordyceps australis map64 (Brazil) OphauB2|4227
Ophiocordyceps camponoti-floridani Ophcf2|04194 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2455
Ophiocordyceps kimflemingae Ophio5|1206
Ophiocordyceps subramaniannii Hirsu2|7288

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04194
MRLTAELIQNSLSYLNPLKERELDLRGQRIPTIENLAAAGPHDCIDFTDNDIQVLGNFPLSPRITTLLMARNRIS
SIQPNLSRSLPNLANLVLSNNNLAELADLDALSGFPHLAHLALVDNPVVKREHYRYWVLWQCPNLRFLDFAKVKQ
AEKERSLELFGTAKKPTALKSEIMARKTTSFELSTNGSTGVSKLSRMMLTDEEKKRLRERIKKATNFREIEALEK
ELNEGRVPSGVQDAMEE*
Coding >Ophcf2|04194
ATGCGGCTCACCGCGGAGCTGATACAGAACTCGCTTTCGTATCTCAACCCGCTCAAGGAACGCGAGCTCGATCTC
CGAGGACAGCGGATACCGACGATTGAGAACCTGGCTGCCGCAGGGCCTCACGATTGTATCGACTTTACCGATAAT
GACATCCAGGTGCTGGGCAATTTCCCGCTCTCGCCGCGCATCACGACGCTTCTGATGGCGCGTAACCGGATTTCG
AGCATTCAGCCAAATCTTTCGCGGTCGCTGCCCAACCTCGCCAACCTGGTTTTGTCGAACAATAACCTGGCGGAG
CTGGCTGACCTCGATGCACTGTCTGGGTTTCCGCACCTGGCGCACCTGGCGCTGGTGGATAACCCCGTCGTCAAG
CGGGAGCATTATCGTTACTGGGTTCTGTGGCAATGCCCCAACCTGCGCTTCCTCGATTTCGCAAAGGTCAAGCAG
GCGGAGAAGGAGAGGAGCCTGGAGCTCTTCGGCACGGCAAAGAAGCCCACGGCGTTGAAATCCGAGATCATGGCC
CGCAAGACGACGTCATTCGAACTGTCGACCAACGGCTCGACTGGCGTGTCCAAGCTGTCACGAATGATGCTCACC
GATGAGGAGAAGAAGCGGCTACGGGAGAGGATCAAGAAGGCGACGAATTTTAGAGAGATTGAAGCGCTGGAAAAG
GAGCTTAATGAGGGGCGGGTGCCCTCGGGGGTTCAGGACGCCATGGAGGAATGA
Transcript >Ophcf2|04194
ATGCGGCTCACCGCGGAGCTGATACAGAACTCGCTTTCGTATCTCAACCCGCTCAAGGAACGCGAGCTCGATCTC
CGAGGACAGCGGATACCGACGATTGAGAACCTGGCTGCCGCAGGGCCTCACGATTGTATCGACTTTACCGATAAT
GACATCCAGGTGCTGGGCAATTTCCCGCTCTCGCCGCGCATCACGACGCTTCTGATGGCGCGTAACCGGATTTCG
AGCATTCAGCCAAATCTTTCGCGGTCGCTGCCCAACCTCGCCAACCTGGTTTTGTCGAACAATAACCTGGCGGAG
CTGGCTGACCTCGATGCACTGTCTGGGTTTCCGCACCTGGCGCACCTGGCGCTGGTGGATAACCCCGTCGTCAAG
CGGGAGCATTATCGTTACTGGGTTCTGTGGCAATGCCCCAACCTGCGCTTCCTCGATTTCGCAAAGGTCAAGCAG
GCGGAGAAGGAGAGGAGCCTGGAGCTCTTCGGCACGGCAAAGAAGCCCACGGCGTTGAAATCCGAGATCATGGCC
CGCAAGACGACGTCATTCGAACTGTCGACCAACGGCTCGACTGGCGTGTCCAAGCTGTCACGAATGATGCTCACC
GATGAGGAGAAGAAGCGGCTACGGGAGAGGATCAAGAAGGCGACGAATTTTAGAGAGATTGAAGCGCTGGAAAAG
GAGCTTAATGAGGGGCGGGTGCCCTCGGGGGTTCAGGACGCCATGGAGGAATGA
Gene >Ophcf2|04194
ATGCGGCTCACCGCGGAGCTGATACAGAACTCGCTTTCGTATCTCAACCCGCTCAAGGAACGCGAGCTCGATCTC
CGAGGTACGTCACGGCCACAGAATAGGGCAGAGAGAGGCCTTCGGCTTCGCAAATAAAAAAAAAGTTAAGGGTTG
TGTTGATGCGAGCGGTTCTTGTTGCCCTTGCGCCTCTCTACAGGACAGCGGATACCGACGATTGAGAACCTGGCT
GCCGCAGGGGTTTGTGTTCCCCCTCTTCGCCAGCTTTTGGGAGGAAGTGGAAGCGCTTGCTGACGCGGAGACGGG
GTATTTAGCCTCACGATTGTATCGACTTTACCGATAATGACATCCAGGTGCTGGGCAATTTCCCGCTCTCGCCGC
GCATCACGACGCTTCTGATGGCGCGTAACCGGATTTCGAGCATTCAGCCAAATCTTTCGCGGTCGCTGCCCAACC
TCGCCAACCTGGTTTTGTCGAACAATAACCTGGCGGAGCTGGCTGACCTCGATGCACTGTCTGGGTTTCCGCACC
TGGCGCACCTGGCGCTGGTGGATAACCCCGTCGTCAAGCGGGAGGCATGTGTTCTTCTATACCTTAGAGACGATA
CGGGCCGGATGAGACGCGTACTGACAGCTTCCGCGCGTGTTGCCTCTTGTATAGCATTATCGTTACTGGGTTCTG
TGGCAATGCCCCAACCTGCGCTTCCTCGATTTCGCAAAGGTCAAGCAGGCGGAGAAGGAGAGGAGCCTGGAGCTC
TTCGGCACGGCAAAGAAGCCCACGGCGTTGAAATCCGAGGCAAGACGATGCCCTCCCTCCCAGAGAGAAAGGGAA
TTTGATCCCCGTACTGATACGCTGAGGGAAGATCATGGCCCGCAAGACGACGTCATTCGAACTGTCGACCAACGG
CTCGACTGGCGTGTCCAAGCTGTCACGAATGATGCTCACCGATGAGGAGAAGAAGCGGCTACGGGAGAGGATCAA
GAAGGCGACGAATTTTAGAGAGATTGAAGCGCTGGAAAAGGAGCTTAATGAGGGGCGGGTGCCCTCGGGGGTTCA
GGACGCCATGGAGGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail