Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04192
Gene name
Locationscaffold_04:1113166..1115847
Strand-
Gene length (bp)2681
Transcript length (bp)2460
Coding sequence length (bp)2460
Protein length (aa) 820

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00654 Voltage_CLC Voltage gated chloride channel 2.6E-86 175 556
PF00571 CBS CBS domain 2.7E-04 689 735

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005247 voltage-gated chloride channel activity Yes
GO:0006821 chloride transport Yes
GO:0055085 transmembrane transport Yes
GO:0015267 channel activity No
GO:0003674 molecular_function No
GO:0015698 inorganic anion transport No
GO:0005215 transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0005244 voltage-gated ion channel activity No
GO:0006810 transport No
GO:0022836 gated channel activity No
GO:0009987 cellular process No
GO:0022832 voltage-gated channel activity No
GO:0110165 cellular anatomical entity No
GO:0008308 voltage-gated anion channel activity No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0006820 anion transport No
GO:0022803 passive transmembrane transporter activity No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0015108 chloride transmembrane transporter activity No
GO:0005254 chloride channel activity No
GO:0006811 ion transport No
GO:0008150 biological_process No
GO:0005253 anion channel activity No
GO:0051179 localization No
GO:0005216 ion channel activity No
GO:0008509 anion transmembrane transporter activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole Signal peptide|Transmembrane domain 0.1269 0.1494 0.0228 0.386 0.1377 0.0114 0.3224 0.6615 0.5315 0.0178

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 99 121 22
2 167 189 22
3 210 232 22
4 267 289 22
5 302 324 22
6 344 366 22
7 379 401 22
8 432 454 22
9 461 483 22
10 508 530 22
11 537 559 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 42.99 24.70 61.27
Alive In ants, during behavior modification 68.47 36.79 100.15
Dead In ants, recently dead 57.78 32.57 82.99

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.013092 yes
Alive Dead 0.349505 no
Dead Fungus 0.115094 no

Orthologs

Orthofinder run ID4
Orthogroup190
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4843
Ophiocordyceps australis 1348a (Ghana) OphauG2|4975
Ophiocordyceps australis map64 (Brazil) OphauB2|4225
Ophiocordyceps australis map64 (Brazil) OphauB2|6944
Ophiocordyceps camponoti-floridani Ophcf2|01885
Ophiocordyceps camponoti-floridani Ophcf2|04192 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2457
Ophiocordyceps camponoti-rufipedis Ophun1|4669
Ophiocordyceps kimflemingae Ophio5|1204
Ophiocordyceps kimflemingae Ophio5|4044
Ophiocordyceps subramaniannii Hirsu2|581
Ophiocordyceps subramaniannii Hirsu2|7290

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04192
MNPPSASFGRHRRPSISSRLYSADGGEAAVATGTGRAPIDEAIAEIKRYEDFSTIDWVQDAAREQARRKFRRRRA
AGLYVRGGSGWRYRLWAWYDAAQGWIVVTIIGVAIGLNAAFLNIITEWLSDIKMGYCSTAFYLNQNFCCWGERNG
CEHWHRWAGFEPLNYLLYIVFATLFAFVSATLVKSFAPYAAGSGISEIKCIIAGFVMKGFLGLRTLLIKSVCLPL
AIASGLSVGKEGPSVHYAVCTGNVVSRLFTKYRGNAGKTREILSACAAAGVAVAFGSPIGGVLFSLEEMSNYFPL
KTMWRSYFCALVATAVLAAMNPFRTGQLVMFQVSYDRDWHFFEVLFYVVIGLFGGLYGALVIKWNLRAQAFRKKY
LTRYAVLEATLLAAATAVVAYPNAILRIDMTESMEQLFLECEAGADHHGLCESDRRVANVTSLVLATVLRIFLVI
ISYGCKVPAGIFVPSMAIGASFGRTVGILVQALHEANPTGLFFSACKVDEPCITPGTYAFLGAAAALSGIMHITV
SVVVIMFELTGALTYILPTMIVVGVTKAVSDWFGKGGIADRMIWFSGFPFLDNKEDHNFGVPVSHVMGNSVVSLP
VDGLSLGQVEQLLAEDNYQGFPIVEDSRCKILAGYIGRPELQYGIDRIRRERTVVDPSARCVFGRPAEPTAASTD
AAATLDLSGYVDTTPVRVHPKLPLETVMELFRKIGPRVILIEYHGRLTGLVTVKDCLKYQFQVEASENPKDDPRI
LEGQAQLWAALRRIGRWVSDRLWSISGGRIRLGGRSEQGSDRSRGGSILDGDEESVDEGLEMESRRREW*
Coding >Ophcf2|04192
ATGAATCCACCATCCGCGTCCTTCGGCCGTCACCGCCGCCCGTCCATCAGCTCGCGCCTATACAGCGCAGACGGC
GGCGAGGCTGCTGTGGCGACGGGCACGGGCAGGGCGCCCATCGACGAGGCCATAGCCGAGATCAAGCGCTACGAG
GATTTTTCTACCATCGACTGGGTGCAGGATGCGGCTCGCGAACAGGCGAGACGCAAGTTTCGTCGCAGACGGGCG
GCTGGACTCTACGTCCGCGGCGGCTCTGGGTGGCGGTATCGGCTTTGGGCATGGTATGATGCGGCTCAGGGATGG
ATCGTCGTCACCATCATTGGTGTTGCCATTGGGCTTAACGCCGCTTTTCTCAACATCATTACCGAGTGGTTGTCG
GATATCAAGATGGGCTACTGCTCGACTGCCTTTTATCTCAATCAGAACTTCTGCTGCTGGGGCGAGCGGAACGGC
TGTGAGCACTGGCATCGATGGGCCGGCTTCGAACCTCTCAACTACTTGCTTTACATTGTCTTTGCTACGCTCTTC
GCCTTCGTTTCGGCCACGCTGGTCAAGTCATTTGCGCCCTACGCGGCCGGCTCAGGCATCTCGGAGATCAAGTGC
ATCATCGCCGGCTTCGTCATGAAAGGCTTCCTCGGCCTCCGCACGCTGCTGATAAAGTCTGTCTGCCTGCCACTG
GCCATCGCCTCAGGACTATCTGTCGGTAAGGAGGGCCCCAGCGTGCATTACGCCGTCTGCACCGGCAACGTCGTC
TCGCGCCTCTTCACCAAGTATCGCGGGAACGCGGGCAAGACGCGGGAGATCCTCAGCGCCTGCGCGGCTGCCGGT
GTCGCTGTCGCCTTCGGGAGTCCCATCGGCGGCGTCCTCTTCTCGCTCGAGGAGATGTCCAATTACTTTCCCCTC
AAGACGATGTGGCGCAGCTACTTTTGCGCTCTCGTCGCTACGGCTGTCCTGGCGGCCATGAACCCCTTTCGCACC
GGCCAGCTCGTCATGTTCCAGGTCAGCTACGACCGTGACTGGCACTTCTTTGAGGTGCTTTTCTACGTCGTCATC
GGTCTGTTCGGCGGCCTCTATGGCGCTCTCGTCATCAAGTGGAATCTGCGAGCTCAGGCTTTTCGCAAGAAGTAT
CTCACCCGTTATGCCGTCCTCGAGGCCACCCTGCTGGCGGCTGCCACCGCCGTCGTCGCGTATCCCAACGCCATC
CTCCGCATCGACATGACGGAGAGCATGGAGCAGCTCTTCCTCGAGTGTGAGGCTGGCGCGGACCATCACGGCCTC
TGCGAGTCCGATCGCCGCGTGGCCAACGTGACCTCACTCGTTCTGGCCACCGTCCTCAGGATCTTCCTCGTCATC
ATCTCGTATGGCTGCAAGGTGCCGGCCGGCATCTTCGTCCCGTCTATGGCTATCGGCGCCTCCTTCGGCCGCACC
GTCGGCATACTCGTTCAGGCGCTGCACGAGGCCAATCCGACCGGACTCTTCTTCTCCGCCTGCAAGGTCGACGAG
CCCTGCATCACACCGGGCACGTACGCCTTCCTGGGCGCTGCCGCCGCTCTGAGCGGCATCATGCACATTACCGTG
TCCGTCGTCGTCATCATGTTTGAGCTGACAGGCGCCCTGACTTACATACTGCCCACCATGATCGTCGTCGGCGTC
ACAAAGGCCGTGAGCGACTGGTTCGGTAAGGGGGGCATTGCTGACCGTATGATCTGGTTCAGCGGCTTCCCCTTC
CTCGACAATAAGGAGGATCACAACTTTGGCGTGCCCGTTTCGCACGTCATGGGGAACTCAGTCGTGTCCCTGCCC
GTCGACGGTTTGAGCCTCGGCCAGGTCGAGCAGCTGCTAGCGGAAGACAATTATCAGGGTTTCCCCATTGTCGAG
GACAGCCGTTGCAAGATTCTGGCCGGTTACATCGGCCGGCCGGAGCTGCAGTACGGCATCGACCGCATCCGCCGG
GAGCGGACAGTCGTCGACCCGAGCGCCCGATGCGTGTTTGGGCGGCCGGCCGAGCCGACGGCGGCCAGCACCGAC
GCGGCAGCGACGCTCGACCTGAGCGGCTACGTCGACACGACGCCGGTCCGGGTTCATCCCAAGCTTCCGCTCGAA
ACGGTCATGGAGCTATTCCGCAAGATCGGGCCGCGGGTGATCCTCATCGAGTATCACGGCCGGCTGACGGGTCTG
GTGACGGTCAAGGACTGCCTCAAGTATCAGTTCCAGGTGGAGGCGTCGGAGAATCCCAAGGACGACCCGCGGATA
CTGGAGGGCCAAGCGCAGCTGTGGGCGGCGCTGCGTCGGATTGGCCGCTGGGTGTCGGACCGGTTGTGGAGCATA
TCCGGGGGCAGGATACGGCTCGGGGGCCGGAGCGAGCAGGGTTCGGACCGGAGTAGGGGCGGTTCCATACTCGAT
GGCGACGAGGAATCGGTTGACGAGGGCTTGGAGATGGAGAGTCGGCGTAGGGAGTGGTAG
Transcript >Ophcf2|04192
ATGAATCCACCATCCGCGTCCTTCGGCCGTCACCGCCGCCCGTCCATCAGCTCGCGCCTATACAGCGCAGACGGC
GGCGAGGCTGCTGTGGCGACGGGCACGGGCAGGGCGCCCATCGACGAGGCCATAGCCGAGATCAAGCGCTACGAG
GATTTTTCTACCATCGACTGGGTGCAGGATGCGGCTCGCGAACAGGCGAGACGCAAGTTTCGTCGCAGACGGGCG
GCTGGACTCTACGTCCGCGGCGGCTCTGGGTGGCGGTATCGGCTTTGGGCATGGTATGATGCGGCTCAGGGATGG
ATCGTCGTCACCATCATTGGTGTTGCCATTGGGCTTAACGCCGCTTTTCTCAACATCATTACCGAGTGGTTGTCG
GATATCAAGATGGGCTACTGCTCGACTGCCTTTTATCTCAATCAGAACTTCTGCTGCTGGGGCGAGCGGAACGGC
TGTGAGCACTGGCATCGATGGGCCGGCTTCGAACCTCTCAACTACTTGCTTTACATTGTCTTTGCTACGCTCTTC
GCCTTCGTTTCGGCCACGCTGGTCAAGTCATTTGCGCCCTACGCGGCCGGCTCAGGCATCTCGGAGATCAAGTGC
ATCATCGCCGGCTTCGTCATGAAAGGCTTCCTCGGCCTCCGCACGCTGCTGATAAAGTCTGTCTGCCTGCCACTG
GCCATCGCCTCAGGACTATCTGTCGGTAAGGAGGGCCCCAGCGTGCATTACGCCGTCTGCACCGGCAACGTCGTC
TCGCGCCTCTTCACCAAGTATCGCGGGAACGCGGGCAAGACGCGGGAGATCCTCAGCGCCTGCGCGGCTGCCGGT
GTCGCTGTCGCCTTCGGGAGTCCCATCGGCGGCGTCCTCTTCTCGCTCGAGGAGATGTCCAATTACTTTCCCCTC
AAGACGATGTGGCGCAGCTACTTTTGCGCTCTCGTCGCTACGGCTGTCCTGGCGGCCATGAACCCCTTTCGCACC
GGCCAGCTCGTCATGTTCCAGGTCAGCTACGACCGTGACTGGCACTTCTTTGAGGTGCTTTTCTACGTCGTCATC
GGTCTGTTCGGCGGCCTCTATGGCGCTCTCGTCATCAAGTGGAATCTGCGAGCTCAGGCTTTTCGCAAGAAGTAT
CTCACCCGTTATGCCGTCCTCGAGGCCACCCTGCTGGCGGCTGCCACCGCCGTCGTCGCGTATCCCAACGCCATC
CTCCGCATCGACATGACGGAGAGCATGGAGCAGCTCTTCCTCGAGTGTGAGGCTGGCGCGGACCATCACGGCCTC
TGCGAGTCCGATCGCCGCGTGGCCAACGTGACCTCACTCGTTCTGGCCACCGTCCTCAGGATCTTCCTCGTCATC
ATCTCGTATGGCTGCAAGGTGCCGGCCGGCATCTTCGTCCCGTCTATGGCTATCGGCGCCTCCTTCGGCCGCACC
GTCGGCATACTCGTTCAGGCGCTGCACGAGGCCAATCCGACCGGACTCTTCTTCTCCGCCTGCAAGGTCGACGAG
CCCTGCATCACACCGGGCACGTACGCCTTCCTGGGCGCTGCCGCCGCTCTGAGCGGCATCATGCACATTACCGTG
TCCGTCGTCGTCATCATGTTTGAGCTGACAGGCGCCCTGACTTACATACTGCCCACCATGATCGTCGTCGGCGTC
ACAAAGGCCGTGAGCGACTGGTTCGGTAAGGGGGGCATTGCTGACCGTATGATCTGGTTCAGCGGCTTCCCCTTC
CTCGACAATAAGGAGGATCACAACTTTGGCGTGCCCGTTTCGCACGTCATGGGGAACTCAGTCGTGTCCCTGCCC
GTCGACGGTTTGAGCCTCGGCCAGGTCGAGCAGCTGCTAGCGGAAGACAATTATCAGGGTTTCCCCATTGTCGAG
GACAGCCGTTGCAAGATTCTGGCCGGTTACATCGGCCGGCCGGAGCTGCAGTACGGCATCGACCGCATCCGCCGG
GAGCGGACAGTCGTCGACCCGAGCGCCCGATGCGTGTTTGGGCGGCCGGCCGAGCCGACGGCGGCCAGCACCGAC
GCGGCAGCGACGCTCGACCTGAGCGGCTACGTCGACACGACGCCGGTCCGGGTTCATCCCAAGCTTCCGCTCGAA
ACGGTCATGGAGCTATTCCGCAAGATCGGGCCGCGGGTGATCCTCATCGAGTATCACGGCCGGCTGACGGGTCTG
GTGACGGTCAAGGACTGCCTCAAGTATCAGTTCCAGGTGGAGGCGTCGGAGAATCCCAAGGACGACCCGCGGATA
CTGGAGGGCCAAGCGCAGCTGTGGGCGGCGCTGCGTCGGATTGGCCGCTGGGTGTCGGACCGGTTGTGGAGCATA
TCCGGGGGCAGGATACGGCTCGGGGGCCGGAGCGAGCAGGGTTCGGACCGGAGTAGGGGCGGTTCCATACTCGAT
GGCGACGAGGAATCGGTTGACGAGGGCTTGGAGATGGAGAGTCGGCGTAGGGAGTGGTAG
Gene >Ophcf2|04192
ATGAATCCACCATCCGCGTCCTTCGGCCGTCACCGCCGCCCGTCCATCAGCTCGCGCCTATACAGCGCAGACGGC
GGCGAGGCTGCTGTGGCGACGGGCACGGGCAGGGCGCCCATCGACGAGGCCATAGCCGAGATCAAGCGCTACGAG
GTGAGACGGCTTCCTTCGATTAGCATTGGGATTGGTCTTTGCTGATCCGAGACGACTAGGATTTTTCTACCATCG
GTGCGGACGGACCTGGATCCAGGCTGGCGTTGGGCTGACGAGCTTCCTTCCTTTCAGACTGGGTGCAGGATGCGG
CTCGCGAACAGGCGAGACGCAAGTTTCGTCGCAGACGGGCGGCTGGACTCTACGTCCGCGGCGGCTCTGGGTGGC
GGTATCGGCTTTGGGCATGGTATGATGCGGCTCAGGGATGGATCGTCGTCACCATCATTGGTGTTGCCATTGGGC
TTAACGCCGCTTTTCTCAACATCATTACCGAGTGGTTGTCGGATATCAAGATGGGCTACTGCTCGACTGCCTTTT
ATCTCAATCAGAACTTCTGCTGCTGGGGCGAGCGGAACGGTATGTTTGTCGCTTGTCTCTGGTTCTGGCCCTGAC
GAACGGTTAGGCTGTGAGCACTGGCATCGATGGGCCGGCTTCGAACCTCTCAACTACTTGCTTTACATTGTCTTT
GCTGTATGTTTTTTCGAACCCCAATGTCCGCATGTTATGGATGCCCACTCATGACATGGCAGACGCTCTTCGCCT
TCGTTTCGGCCACGCTGGTCAAGTCATTTGCGCCCTACGCGGCCGGCTCAGGCATCTCGGAGATCAAGTGCATCA
TCGCCGGCTTCGTCATGAAAGGCTTCCTCGGCCTCCGCACGCTGCTGATAAAGTCTGTCTGCCTGCCACTGGCCA
TCGCCTCAGGACTATCTGTCGGTAAGGAGGGCCCCAGCGTGCATTACGCCGTCTGCACCGGCAACGTCGTCTCGC
GCCTCTTCACCAAGTATCGCGGGAACGCGGGCAAGACGCGGGAGATCCTCAGCGCCTGCGCGGCTGCCGGTGTCG
CTGTCGCCTTCGGGAGTCCCATCGGCGGCGTCCTCTTCTCGCTCGAGGAGATGTCCAATTACTTTCCCCTCAAGA
CGATGTGGCGCAGCTACTTTTGCGCTCTCGTCGCTACGGCTGTCCTGGCGGCCATGAACCCCTTTCGCACCGGCC
AGCTCGTCATGTTCCAGGTCAGCTACGACCGTGACTGGCACTTCTTTGAGGTGCTTTTCTACGTCGTCATCGGTC
TGTTCGGCGGCCTCTATGGCGCTCTCGTCATCAAGTGGAATCTGCGAGCTCAGGCTTTTCGCAAGAAGTATCTCA
CCCGTTATGCCGTCCTCGAGGCCACCCTGCTGGCGGCTGCCACCGCCGTCGTCGCGTATCCCAACGCCATCCTCC
GCATCGACATGACGGAGAGCATGGAGCAGCTCTTCCTCGAGTGTGAGGCTGGCGCGGACCATCACGGCCTCTGCG
AGTCCGATCGCCGCGTGGCCAACGTGACCTCACTCGTTCTGGCCACCGTCCTCAGGATCTTCCTCGTCATCATCT
CGTATGGCTGCAAGGTGCCGGCCGGCATCTTCGTCCCGTCTATGGCTATCGGCGCCTCCTTCGGCCGCACCGTCG
GCATACTCGTTCAGGCGCTGCACGAGGCCAATCCGACCGGACTCTTCTTCTCCGCCTGCAAGGTCGACGAGCCCT
GCATCACACCGGGCACGTACGCCTTCCTGGGCGCTGCCGCCGCTCTGAGCGGCATCATGCACATTACCGTGTCCG
TCGTCGTCATCATGTTTGAGCTGACAGGCGCCCTGACTTACATACTGCCCACCATGATCGTCGTCGGCGTCACAA
AGGCCGTGAGCGACTGGTTCGGTAAGGGGGGCATTGCTGACCGTATGATCTGGTTCAGCGGCTTCCCCTTCCTCG
ACAATAAGGAGGATCACAACTTTGGCGTGCCCGTTTCGCACGTCATGGGGAACTCAGTCGTGTCCCTGCCCGTCG
ACGGTTTGAGCCTCGGCCAGGTCGAGCAGCTGCTAGCGGAAGACAATTATCAGGGTTTCCCCATTGTCGAGGACA
GCCGTTGCAAGATTCTGGCCGGTTACATCGGCCGGCCGGAGCTGCAGTACGGCATCGACCGCATCCGCCGGGAGC
GGACAGTCGTCGACCCGAGCGCCCGATGCGTGTTTGGGCGGCCGGCCGAGCCGACGGCGGCCAGCACCGACGCGG
CAGCGACGCTCGACCTGAGCGGCTACGTCGACACGACGCCGGTCCGGGTTCATCCCAAGCTTCCGCTCGAAACGG
TCATGGAGCTATTCCGCAAGATCGGGCCGCGGGTGATCCTCATCGAGTATCACGGCCGGCTGACGGGTCTGGTGA
CGGTCAAGGACTGCCTCAAGTATCAGTTCCAGGTGGAGGCGTCGGAGAATCCCAAGGACGACCCGCGGATACTGG
AGGGCCAAGCGCAGCTGTGGGCGGCGCTGCGTCGGATTGGCCGCTGGGTGTCGGACCGGTTGTGGAGCATATCCG
GGGGCAGGATACGGCTCGGGGGCCGGAGCGAGCAGGGTTCGGACCGGAGTAGGGGCGGTTCCATACTCGATGGCG
ACGAGGAATCGGTTGACGAGGGCTTGGAGATGGAGAGTCGGCGTAGGGAGTGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail