Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04192
Gene name
Locationscaffold_04:1113166..1115847
Strand-
Gene length (bp)2681
Transcript length (bp)2460
Coding sequence length (bp)2460
Protein length (aa) 820

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00654 Voltage_CLC Voltage gated chloride channel 2.6E-86 175 556
PF00571 CBS CBS domain 2.7E-04 689 735

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005247 voltage-gated chloride channel activity Yes
GO:0006821 chloride transport Yes
GO:0055085 transmembrane transport Yes
GO:0015267 channel activity No
GO:0003674 molecular_function No
GO:0015698 inorganic anion transport No
GO:0005215 transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0005244 voltage-gated ion channel activity No
GO:0006810 transport No
GO:0022836 gated channel activity No
GO:0009987 cellular process No
GO:0022832 voltage-gated channel activity No
GO:0110165 cellular anatomical entity No
GO:0008308 voltage-gated anion channel activity No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0006820 anion transport No
GO:0022803 passive transmembrane transporter activity No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0015108 chloride transmembrane transporter activity No
GO:0005254 chloride channel activity No
GO:0006811 ion transport No
GO:0008150 biological_process No
GO:0005253 anion channel activity No
GO:0051179 localization No
GO:0005216 ion channel activity No
GO:0008509 anion transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 99 121 22
2 167 189 22
3 210 232 22
4 267 289 22
5 302 324 22
6 344 366 22
7 379 401 22
8 432 454 22
9 461 483 22
10 508 530 22
11 537 559 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04192
MNPPSASFGRHRRPSISSRLYSADGGEAAVATGTGRAPIDEAIAEIKRYEDFSTIDWVQDAAREQARRKFRRRRA
AGLYVRGGSGWRYRLWAWYDAAQGWIVVTIIGVAIGLNAAFLNIITEWLSDIKMGYCSTAFYLNQNFCCWGERNG
CEHWHRWAGFEPLNYLLYIVFATLFAFVSATLVKSFAPYAAGSGISEIKCIIAGFVMKGFLGLRTLLIKSVCLPL
AIASGLSVGKEGPSVHYAVCTGNVVSRLFTKYRGNAGKTREILSACAAAGVAVAFGSPIGGVLFSLEEMSNYFPL
KTMWRSYFCALVATAVLAAMNPFRTGQLVMFQVSYDRDWHFFEVLFYVVIGLFGGLYGALVIKWNLRAQAFRKKY
LTRYAVLEATLLAAATAVVAYPNAILRIDMTESMEQLFLECEAGADHHGLCESDRRVANVTSLVLATVLRIFLVI
ISYGCKVPAGIFVPSMAIGASFGRTVGILVQALHEANPTGLFFSACKVDEPCITPGTYAFLGAAAALSGIMHITV
SVVVIMFELTGALTYILPTMIVVGVTKAVSDWFGKGGIADRMIWFSGFPFLDNKEDHNFGVPVSHVMGNSVVSLP
VDGLSLGQVEQLLAEDNYQGFPIVEDSRCKILAGYIGRPELQYGIDRIRRERTVVDPSARCVFGRPAEPTAASTD
AAATLDLSGYVDTTPVRVHPKLPLETVMELFRKIGPRVILIEYHGRLTGLVTVKDCLKYQFQVEASENPKDDPRI
LEGQAQLWAALRRIGRWVSDRLWSISGGRIRLGGRSEQGSDRSRGGSILDGDEESVDEGLEMESRRREW*
Coding >Ophcf2|04192
ATGAATCCACCATCCGCGTCCTTCGGCCGTCACCGCCGCCCGTCCATCAGCTCGCGCCTATACAGCGCAGACGGC
GGCGAGGCTGCTGTGGCGACGGGCACGGGCAGGGCGCCCATCGACGAGGCCATAGCCGAGATCAAGCGCTACGAG
GATTTTTCTACCATCGACTGGGTGCAGGATGCGGCTCGCGAACAGGCGAGACGCAAGTTTCGTCGCAGACGGGCG
GCTGGACTCTACGTCCGCGGCGGCTCTGGGTGGCGGTATCGGCTTTGGGCATGGTATGATGCGGCTCAGGGATGG
ATCGTCGTCACCATCATTGGTGTTGCCATTGGGCTTAACGCCGCTTTTCTCAACATCATTACCGAGTGGTTGTCG
GATATCAAGATGGGCTACTGCTCGACTGCCTTTTATCTCAATCAGAACTTCTGCTGCTGGGGCGAGCGGAACGGC
TGTGAGCACTGGCATCGATGGGCCGGCTTCGAACCTCTCAACTACTTGCTTTACATTGTCTTTGCTACGCTCTTC
GCCTTCGTTTCGGCCACGCTGGTCAAGTCATTTGCGCCCTACGCGGCCGGCTCAGGCATCTCGGAGATCAAGTGC
ATCATCGCCGGCTTCGTCATGAAAGGCTTCCTCGGCCTCCGCACGCTGCTGATAAAGTCTGTCTGCCTGCCACTG
GCCATCGCCTCAGGACTATCTGTCGGTAAGGAGGGCCCCAGCGTGCATTACGCCGTCTGCACCGGCAACGTCGTC
TCGCGCCTCTTCACCAAGTATCGCGGGAACGCGGGCAAGACGCGGGAGATCCTCAGCGCCTGCGCGGCTGCCGGT
GTCGCTGTCGCCTTCGGGAGTCCCATCGGCGGCGTCCTCTTCTCGCTCGAGGAGATGTCCAATTACTTTCCCCTC
AAGACGATGTGGCGCAGCTACTTTTGCGCTCTCGTCGCTACGGCTGTCCTGGCGGCCATGAACCCCTTTCGCACC
GGCCAGCTCGTCATGTTCCAGGTCAGCTACGACCGTGACTGGCACTTCTTTGAGGTGCTTTTCTACGTCGTCATC
GGTCTGTTCGGCGGCCTCTATGGCGCTCTCGTCATCAAGTGGAATCTGCGAGCTCAGGCTTTTCGCAAGAAGTAT
CTCACCCGTTATGCCGTCCTCGAGGCCACCCTGCTGGCGGCTGCCACCGCCGTCGTCGCGTATCCCAACGCCATC
CTCCGCATCGACATGACGGAGAGCATGGAGCAGCTCTTCCTCGAGTGTGAGGCTGGCGCGGACCATCACGGCCTC
TGCGAGTCCGATCGCCGCGTGGCCAACGTGACCTCACTCGTTCTGGCCACCGTCCTCAGGATCTTCCTCGTCATC
ATCTCGTATGGCTGCAAGGTGCCGGCCGGCATCTTCGTCCCGTCTATGGCTATCGGCGCCTCCTTCGGCCGCACC
GTCGGCATACTCGTTCAGGCGCTGCACGAGGCCAATCCGACCGGACTCTTCTTCTCCGCCTGCAAGGTCGACGAG
CCCTGCATCACACCGGGCACGTACGCCTTCCTGGGCGCTGCCGCCGCTCTGAGCGGCATCATGCACATTACCGTG
TCCGTCGTCGTCATCATGTTTGAGCTGACAGGCGCCCTGACTTACATACTGCCCACCATGATCGTCGTCGGCGTC
ACAAAGGCCGTGAGCGACTGGTTCGGTAAGGGGGGCATTGCTGACCGTATGATCTGGTTCAGCGGCTTCCCCTTC
CTCGACAATAAGGAGGATCACAACTTTGGCGTGCCCGTTTCGCACGTCATGGGGAACTCAGTCGTGTCCCTGCCC
GTCGACGGTTTGAGCCTCGGCCAGGTCGAGCAGCTGCTAGCGGAAGACAATTATCAGGGTTTCCCCATTGTCGAG
GACAGCCGTTGCAAGATTCTGGCCGGTTACATCGGCCGGCCGGAGCTGCAGTACGGCATCGACCGCATCCGCCGG
GAGCGGACAGTCGTCGACCCGAGCGCCCGATGCGTGTTTGGGCGGCCGGCCGAGCCGACGGCGGCCAGCACCGAC
GCGGCAGCGACGCTCGACCTGAGCGGCTACGTCGACACGACGCCGGTCCGGGTTCATCCCAAGCTTCCGCTCGAA
ACGGTCATGGAGCTATTCCGCAAGATCGGGCCGCGGGTGATCCTCATCGAGTATCACGGCCGGCTGACGGGTCTG
GTGACGGTCAAGGACTGCCTCAAGTATCAGTTCCAGGTGGAGGCGTCGGAGAATCCCAAGGACGACCCGCGGATA
CTGGAGGGCCAAGCGCAGCTGTGGGCGGCGCTGCGTCGGATTGGCCGCTGGGTGTCGGACCGGTTGTGGAGCATA
TCCGGGGGCAGGATACGGCTCGGGGGCCGGAGCGAGCAGGGTTCGGACCGGAGTAGGGGCGGTTCCATACTCGAT
GGCGACGAGGAATCGGTTGACGAGGGCTTGGAGATGGAGAGTCGGCGTAGGGAGTGGTAG
Transcript >Ophcf2|04192
ATGAATCCACCATCCGCGTCCTTCGGCCGTCACCGCCGCCCGTCCATCAGCTCGCGCCTATACAGCGCAGACGGC
GGCGAGGCTGCTGTGGCGACGGGCACGGGCAGGGCGCCCATCGACGAGGCCATAGCCGAGATCAAGCGCTACGAG
GATTTTTCTACCATCGACTGGGTGCAGGATGCGGCTCGCGAACAGGCGAGACGCAAGTTTCGTCGCAGACGGGCG
GCTGGACTCTACGTCCGCGGCGGCTCTGGGTGGCGGTATCGGCTTTGGGCATGGTATGATGCGGCTCAGGGATGG
ATCGTCGTCACCATCATTGGTGTTGCCATTGGGCTTAACGCCGCTTTTCTCAACATCATTACCGAGTGGTTGTCG
GATATCAAGATGGGCTACTGCTCGACTGCCTTTTATCTCAATCAGAACTTCTGCTGCTGGGGCGAGCGGAACGGC
TGTGAGCACTGGCATCGATGGGCCGGCTTCGAACCTCTCAACTACTTGCTTTACATTGTCTTTGCTACGCTCTTC
GCCTTCGTTTCGGCCACGCTGGTCAAGTCATTTGCGCCCTACGCGGCCGGCTCAGGCATCTCGGAGATCAAGTGC
ATCATCGCCGGCTTCGTCATGAAAGGCTTCCTCGGCCTCCGCACGCTGCTGATAAAGTCTGTCTGCCTGCCACTG
GCCATCGCCTCAGGACTATCTGTCGGTAAGGAGGGCCCCAGCGTGCATTACGCCGTCTGCACCGGCAACGTCGTC
TCGCGCCTCTTCACCAAGTATCGCGGGAACGCGGGCAAGACGCGGGAGATCCTCAGCGCCTGCGCGGCTGCCGGT
GTCGCTGTCGCCTTCGGGAGTCCCATCGGCGGCGTCCTCTTCTCGCTCGAGGAGATGTCCAATTACTTTCCCCTC
AAGACGATGTGGCGCAGCTACTTTTGCGCTCTCGTCGCTACGGCTGTCCTGGCGGCCATGAACCCCTTTCGCACC
GGCCAGCTCGTCATGTTCCAGGTCAGCTACGACCGTGACTGGCACTTCTTTGAGGTGCTTTTCTACGTCGTCATC
GGTCTGTTCGGCGGCCTCTATGGCGCTCTCGTCATCAAGTGGAATCTGCGAGCTCAGGCTTTTCGCAAGAAGTAT
CTCACCCGTTATGCCGTCCTCGAGGCCACCCTGCTGGCGGCTGCCACCGCCGTCGTCGCGTATCCCAACGCCATC
CTCCGCATCGACATGACGGAGAGCATGGAGCAGCTCTTCCTCGAGTGTGAGGCTGGCGCGGACCATCACGGCCTC
TGCGAGTCCGATCGCCGCGTGGCCAACGTGACCTCACTCGTTCTGGCCACCGTCCTCAGGATCTTCCTCGTCATC
ATCTCGTATGGCTGCAAGGTGCCGGCCGGCATCTTCGTCCCGTCTATGGCTATCGGCGCCTCCTTCGGCCGCACC
GTCGGCATACTCGTTCAGGCGCTGCACGAGGCCAATCCGACCGGACTCTTCTTCTCCGCCTGCAAGGTCGACGAG
CCCTGCATCACACCGGGCACGTACGCCTTCCTGGGCGCTGCCGCCGCTCTGAGCGGCATCATGCACATTACCGTG
TCCGTCGTCGTCATCATGTTTGAGCTGACAGGCGCCCTGACTTACATACTGCCCACCATGATCGTCGTCGGCGTC
ACAAAGGCCGTGAGCGACTGGTTCGGTAAGGGGGGCATTGCTGACCGTATGATCTGGTTCAGCGGCTTCCCCTTC
CTCGACAATAAGGAGGATCACAACTTTGGCGTGCCCGTTTCGCACGTCATGGGGAACTCAGTCGTGTCCCTGCCC
GTCGACGGTTTGAGCCTCGGCCAGGTCGAGCAGCTGCTAGCGGAAGACAATTATCAGGGTTTCCCCATTGTCGAG
GACAGCCGTTGCAAGATTCTGGCCGGTTACATCGGCCGGCCGGAGCTGCAGTACGGCATCGACCGCATCCGCCGG
GAGCGGACAGTCGTCGACCCGAGCGCCCGATGCGTGTTTGGGCGGCCGGCCGAGCCGACGGCGGCCAGCACCGAC
GCGGCAGCGACGCTCGACCTGAGCGGCTACGTCGACACGACGCCGGTCCGGGTTCATCCCAAGCTTCCGCTCGAA
ACGGTCATGGAGCTATTCCGCAAGATCGGGCCGCGGGTGATCCTCATCGAGTATCACGGCCGGCTGACGGGTCTG
GTGACGGTCAAGGACTGCCTCAAGTATCAGTTCCAGGTGGAGGCGTCGGAGAATCCCAAGGACGACCCGCGGATA
CTGGAGGGCCAAGCGCAGCTGTGGGCGGCGCTGCGTCGGATTGGCCGCTGGGTGTCGGACCGGTTGTGGAGCATA
TCCGGGGGCAGGATACGGCTCGGGGGCCGGAGCGAGCAGGGTTCGGACCGGAGTAGGGGCGGTTCCATACTCGAT
GGCGACGAGGAATCGGTTGACGAGGGCTTGGAGATGGAGAGTCGGCGTAGGGAGTGGTAG
Gene >Ophcf2|04192
ATGAATCCACCATCCGCGTCCTTCGGCCGTCACCGCCGCCCGTCCATCAGCTCGCGCCTATACAGCGCAGACGGC
GGCGAGGCTGCTGTGGCGACGGGCACGGGCAGGGCGCCCATCGACGAGGCCATAGCCGAGATCAAGCGCTACGAG
GTGAGACGGCTTCCTTCGATTAGCATTGGGATTGGTCTTTGCTGATCCGAGACGACTAGGATTTTTCTACCATCG
GTGCGGACGGACCTGGATCCAGGCTGGCGTTGGGCTGACGAGCTTCCTTCCTTTCAGACTGGGTGCAGGATGCGG
CTCGCGAACAGGCGAGACGCAAGTTTCGTCGCAGACGGGCGGCTGGACTCTACGTCCGCGGCGGCTCTGGGTGGC
GGTATCGGCTTTGGGCATGGTATGATGCGGCTCAGGGATGGATCGTCGTCACCATCATTGGTGTTGCCATTGGGC
TTAACGCCGCTTTTCTCAACATCATTACCGAGTGGTTGTCGGATATCAAGATGGGCTACTGCTCGACTGCCTTTT
ATCTCAATCAGAACTTCTGCTGCTGGGGCGAGCGGAACGGTATGTTTGTCGCTTGTCTCTGGTTCTGGCCCTGAC
GAACGGTTAGGCTGTGAGCACTGGCATCGATGGGCCGGCTTCGAACCTCTCAACTACTTGCTTTACATTGTCTTT
GCTGTATGTTTTTTCGAACCCCAATGTCCGCATGTTATGGATGCCCACTCATGACATGGCAGACGCTCTTCGCCT
TCGTTTCGGCCACGCTGGTCAAGTCATTTGCGCCCTACGCGGCCGGCTCAGGCATCTCGGAGATCAAGTGCATCA
TCGCCGGCTTCGTCATGAAAGGCTTCCTCGGCCTCCGCACGCTGCTGATAAAGTCTGTCTGCCTGCCACTGGCCA
TCGCCTCAGGACTATCTGTCGGTAAGGAGGGCCCCAGCGTGCATTACGCCGTCTGCACCGGCAACGTCGTCTCGC
GCCTCTTCACCAAGTATCGCGGGAACGCGGGCAAGACGCGGGAGATCCTCAGCGCCTGCGCGGCTGCCGGTGTCG
CTGTCGCCTTCGGGAGTCCCATCGGCGGCGTCCTCTTCTCGCTCGAGGAGATGTCCAATTACTTTCCCCTCAAGA
CGATGTGGCGCAGCTACTTTTGCGCTCTCGTCGCTACGGCTGTCCTGGCGGCCATGAACCCCTTTCGCACCGGCC
AGCTCGTCATGTTCCAGGTCAGCTACGACCGTGACTGGCACTTCTTTGAGGTGCTTTTCTACGTCGTCATCGGTC
TGTTCGGCGGCCTCTATGGCGCTCTCGTCATCAAGTGGAATCTGCGAGCTCAGGCTTTTCGCAAGAAGTATCTCA
CCCGTTATGCCGTCCTCGAGGCCACCCTGCTGGCGGCTGCCACCGCCGTCGTCGCGTATCCCAACGCCATCCTCC
GCATCGACATGACGGAGAGCATGGAGCAGCTCTTCCTCGAGTGTGAGGCTGGCGCGGACCATCACGGCCTCTGCG
AGTCCGATCGCCGCGTGGCCAACGTGACCTCACTCGTTCTGGCCACCGTCCTCAGGATCTTCCTCGTCATCATCT
CGTATGGCTGCAAGGTGCCGGCCGGCATCTTCGTCCCGTCTATGGCTATCGGCGCCTCCTTCGGCCGCACCGTCG
GCATACTCGTTCAGGCGCTGCACGAGGCCAATCCGACCGGACTCTTCTTCTCCGCCTGCAAGGTCGACGAGCCCT
GCATCACACCGGGCACGTACGCCTTCCTGGGCGCTGCCGCCGCTCTGAGCGGCATCATGCACATTACCGTGTCCG
TCGTCGTCATCATGTTTGAGCTGACAGGCGCCCTGACTTACATACTGCCCACCATGATCGTCGTCGGCGTCACAA
AGGCCGTGAGCGACTGGTTCGGTAAGGGGGGCATTGCTGACCGTATGATCTGGTTCAGCGGCTTCCCCTTCCTCG
ACAATAAGGAGGATCACAACTTTGGCGTGCCCGTTTCGCACGTCATGGGGAACTCAGTCGTGTCCCTGCCCGTCG
ACGGTTTGAGCCTCGGCCAGGTCGAGCAGCTGCTAGCGGAAGACAATTATCAGGGTTTCCCCATTGTCGAGGACA
GCCGTTGCAAGATTCTGGCCGGTTACATCGGCCGGCCGGAGCTGCAGTACGGCATCGACCGCATCCGCCGGGAGC
GGACAGTCGTCGACCCGAGCGCCCGATGCGTGTTTGGGCGGCCGGCCGAGCCGACGGCGGCCAGCACCGACGCGG
CAGCGACGCTCGACCTGAGCGGCTACGTCGACACGACGCCGGTCCGGGTTCATCCCAAGCTTCCGCTCGAAACGG
TCATGGAGCTATTCCGCAAGATCGGGCCGCGGGTGATCCTCATCGAGTATCACGGCCGGCTGACGGGTCTGGTGA
CGGTCAAGGACTGCCTCAAGTATCAGTTCCAGGTGGAGGCGTCGGAGAATCCCAAGGACGACCCGCGGATACTGG
AGGGCCAAGCGCAGCTGTGGGCGGCGCTGCGTCGGATTGGCCGCTGGGTGTCGGACCGGTTGTGGAGCATATCCG
GGGGCAGGATACGGCTCGGGGGCCGGAGCGAGCAGGGTTCGGACCGGAGTAGGGGCGGTTCCATACTCGATGGCG
ACGAGGAATCGGTTGACGAGGGCTTGGAGATGGAGAGTCGGCGTAGGGAGTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail