Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04187
Gene name
Locationscaffold_04:1106462..1107012
Strand-
Gene length (bp)550
Transcript length (bp)504
Coding sequence length (bp)504
Protein length (aa) 168

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01900 RNase_P_Rpp14 Rpp14/Pop5 family 2.8E-38 7 133

GO

GO Term Description Terminal node
GO:0030677 ribonuclease P complex Yes
GO:0001682 tRNA 5'-leader removal Yes
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0006399 tRNA metabolic process No
GO:0006396 RNA processing No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:1902555 endoribonuclease complex No
GO:0046483 heterocycle metabolic process No
GO:0008033 tRNA processing No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0032991 protein-containing complex No
GO:1901360 organic cyclic compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0099116 tRNA 5'-end processing No
GO:0005575 cellular_component No
GO:1990904 ribonucleoprotein complex No
GO:0006807 nitrogen compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0034470 ncRNA processing No
GO:0008150 biological_process No
GO:1902494 catalytic complex No
GO:0000966 RNA 5'-end processing No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5354 0.4781 0.1751 0.0401 0.2203 0.005 0.0334 0.1102 0.0936 0.0082

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4457
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|135
Ophiocordyceps australis map64 (Brazil) OphauB2|4220
Ophiocordyceps camponoti-floridani Ophcf2|04187 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3848
Ophiocordyceps kimflemingae Ophio5|1199
Ophiocordyceps subramaniannii Hirsu2|9253

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04187
MVRIKERYLLVNIIYPPSPQKSFTSEATVPNLIVQHQPTVDKLTTQALLKAIRAEIAVLFGDYGSGAFEGHLSVK
YHSLATSTFILRCARAHYKMLWAALTMMTHVPVKDGLPCIFRVVRVSGTMRKAEEEAIRQARQLILATKGSPLSL
ANAAVPSRSLRSQQALE*
Coding >Ophcf2|04187
ATGGTCCGCATCAAGGAGAGATACCTCCTCGTCAACATAATCTACCCGCCGAGCCCTCAAAAGTCTTTCACCAGC
GAGGCCACCGTGCCAAACCTCATCGTCCAGCACCAGCCCACCGTCGACAAACTTACGACGCAGGCGCTGCTCAAG
GCGATCCGAGCCGAGATCGCTGTCCTCTTTGGAGACTACGGATCCGGAGCTTTCGAGGGCCATCTGTCAGTCAAA
TATCACTCCTTGGCCACATCAACTTTCATCCTCAGATGCGCCAGAGCCCACTATAAGATGCTATGGGCGGCCTTG
ACTATGATGACGCACGTCCCCGTCAAGGATGGTCTACCGTGCATCTTTCGCGTTGTTCGTGTCAGTGGCACCATG
CGAAAGGCCGAAGAGGAAGCCATTCGTCAGGCCAGACAGCTCATCCTGGCAACCAAGGGATCGCCTCTCTCACTA
GCAAACGCAGCCGTTCCGTCGCGGAGTTTGCGAAGCCAACAGGCACTCGAATGA
Transcript >Ophcf2|04187
ATGGTCCGCATCAAGGAGAGATACCTCCTCGTCAACATAATCTACCCGCCGAGCCCTCAAAAGTCTTTCACCAGC
GAGGCCACCGTGCCAAACCTCATCGTCCAGCACCAGCCCACCGTCGACAAACTTACGACGCAGGCGCTGCTCAAG
GCGATCCGAGCCGAGATCGCTGTCCTCTTTGGAGACTACGGATCCGGAGCTTTCGAGGGCCATCTGTCAGTCAAA
TATCACTCCTTGGCCACATCAACTTTCATCCTCAGATGCGCCAGAGCCCACTATAAGATGCTATGGGCGGCCTTG
ACTATGATGACGCACGTCCCCGTCAAGGATGGTCTACCGTGCATCTTTCGCGTTGTTCGTGTCAGTGGCACCATG
CGAAAGGCCGAAGAGGAAGCCATTCGTCAGGCCAGACAGCTCATCCTGGCAACCAAGGGATCGCCTCTCTCACTA
GCAAACGCAGCCGTTCCGTCGCGGAGTTTGCGAAGCCAACAGGCACTCGAATGA
Gene >Ophcf2|04187
ATGGTCCGCATCAAGGAGAGATACCTCCTCGTCAACATAATCTACCCGCCGAGCCCTCAAAAGTCTTTCACCAGC
GAGGCCACCGTGCCAAACCTCATCGTCCAGCACCAGCCCACCGTCGACAAACTTACGACGCAGGCGCTGCTCAAG
GCGATCCGAGCCGAGATCGCTGTCCTCTTTGGAGACTACGGATCCGGAGCTTTCGAGGGCCATCTGTCAGGTGAG
AGTGACTCTCTGACGTTAGGCGACATGGCTGACCAGCGCAGTCAAATATCACTCCTTGGCCACATCAACTTTCAT
CCTCAGATGCGCCAGAGCCCACTATAAGATGCTATGGGCGGCCTTGACTATGATGACGCACGTCCCCGTCAAGGA
TGGTCTACCGTGCATCTTTCGCGTTGTTCGTGTCAGTGGCACCATGCGAAAGGCCGAAGAGGAAGCCATTCGTCA
GGCCAGACAGCTCATCCTGGCAACCAAGGGATCGCCTCTCTCACTAGCAAACGCAGCCGTTCCGTCGCGGAGTTT
GCGAAGCCAACAGGCACTCGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail