Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04183
Gene name
Locationscaffold_04:1097490..1098671
Strand+
Gene length (bp)1181
Transcript length (bp)942
Coding sequence length (bp)942
Protein length (aa) 314

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06244 Ccdc124 Coiled-coil domain-containing protein 124 /Oxs1 8.5E-27 203 284

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3508 0.6635 0.0481 0.0447 0.0866 0.0422 0.0349 0.0165 0.024 0.0706

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5704
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6680
Ophiocordyceps australis map64 (Brazil) OphauB2|2760
Ophiocordyceps camponoti-floridani Ophcf2|04183 (this protein)
Ophiocordyceps kimflemingae Ophio5|1195
Ophiocordyceps subramaniannii Hirsu2|8766

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04183
MSGCHVALQKSAVSDQLLTERRNRLSNVVRWQSPSPKPTPRYLPLSSNANVNAPISRAPSLFRTSLSRSGRASHQ
GRGRAASPNATRDLSKQMAGKKGDNSKKAAGNARKAEAAASKAAVEESRLEAAEADKWSKGAKSNAKRETEAAKK
AEQARKKAEKDALLREEEASIGGRDEPKKSKTPVKKSRGLDLSQLDDNDSPAATLNATGIDNALDALDLTAGSDG
TAAIDKHPEKRFAAAYAKYEERRLQEMKADGSGVGLRLEQRKQRIRKEFDKSPENPFNQVTAAYNATRGDVASIR
KDEAAKVEKRLGQ*
Coding >Ophcf2|04183
ATGAGCGGATGTCATGTCGCGCTGCAGAAGAGTGCAGTCTCGGATCAATTGCTGACGGAGCGAAGAAACCGGTTA
AGCAACGTCGTCCGGTGGCAAAGCCCATCACCGAAACCGACACCGCGATATCTGCCGCTGTCGTCCAACGCCAAC
GTCAATGCCCCAATAAGCAGGGCCCCGTCCCTATTCCGAACGTCCCTTTCCCGATCCGGCCGAGCGTCGCACCAA
GGCCGAGGCCGAGCCGCGAGCCCAAACGCCACGAGAGATCTCTCGAAACAAATGGCGGGCAAAAAGGGCGACAAC
AGCAAGAAGGCAGCCGGCAACGCCCGCAAGGCTGAGGCAGCCGCCAGCAAAGCGGCAGTCGAGGAGTCACGGCTG
GAGGCTGCTGAGGCTGACAAATGGTCCAAGGGGGCAAAGAGTAACGCGAAGAGAGAGACGGAAGCGGCCAAGAAA
GCCGAGCAGGCGCGGAAGAAGGCCGAAAAGGACGCCCTCCTCCGCGAGGAAGAGGCATCCATCGGCGGCCGCGAC
GAACCGAAGAAGTCCAAAACACCTGTCAAGAAGTCGCGCGGCCTCGACCTATCACAACTCGACGACAACGACAGC
CCCGCCGCGACGCTCAACGCCACGGGCATCGACAACGCCCTGGATGCCCTCGATCTCACTGCCGGCTCCGACGGC
ACGGCCGCCATCGACAAGCACCCGGAAAAGCGGTTCGCGGCCGCCTACGCAAAGTACGAAGAGCGCCGTCTGCAG
GAGATGAAGGCCGATGGCAGCGGCGTCGGATTGCGCCTCGAACAGCGGAAGCAGAGGATCAGGAAGGAGTTTGAC
AAGAGCCCCGAGAACCCCTTCAACCAAGTGACGGCCGCATACAACGCCACAAGAGGCGATGTAGCAAGTATCCGC
AAGGACGAGGCAGCCAAGGTCGAGAAGCGGCTGGGCCAGTGA
Transcript >Ophcf2|04183
ATGAGCGGATGTCATGTCGCGCTGCAGAAGAGTGCAGTCTCGGATCAATTGCTGACGGAGCGAAGAAACCGGTTA
AGCAACGTCGTCCGGTGGCAAAGCCCATCACCGAAACCGACACCGCGATATCTGCCGCTGTCGTCCAACGCCAAC
GTCAATGCCCCAATAAGCAGGGCCCCGTCCCTATTCCGAACGTCCCTTTCCCGATCCGGCCGAGCGTCGCACCAA
GGCCGAGGCCGAGCCGCGAGCCCAAACGCCACGAGAGATCTCTCGAAACAAATGGCGGGCAAAAAGGGCGACAAC
AGCAAGAAGGCAGCCGGCAACGCCCGCAAGGCTGAGGCAGCCGCCAGCAAAGCGGCAGTCGAGGAGTCACGGCTG
GAGGCTGCTGAGGCTGACAAATGGTCCAAGGGGGCAAAGAGTAACGCGAAGAGAGAGACGGAAGCGGCCAAGAAA
GCCGAGCAGGCGCGGAAGAAGGCCGAAAAGGACGCCCTCCTCCGCGAGGAAGAGGCATCCATCGGCGGCCGCGAC
GAACCGAAGAAGTCCAAAACACCTGTCAAGAAGTCGCGCGGCCTCGACCTATCACAACTCGACGACAACGACAGC
CCCGCCGCGACGCTCAACGCCACGGGCATCGACAACGCCCTGGATGCCCTCGATCTCACTGCCGGCTCCGACGGC
ACGGCCGCCATCGACAAGCACCCGGAAAAGCGGTTCGCGGCCGCCTACGCAAAGTACGAAGAGCGCCGTCTGCAG
GAGATGAAGGCCGATGGCAGCGGCGTCGGATTGCGCCTCGAACAGCGGAAGCAGAGGATCAGGAAGGAGTTTGAC
AAGAGCCCCGAGAACCCCTTCAACCAAGTGACGGCCGCATACAACGCCACAAGAGGCGATGTAGCAAGTATCCGC
AAGGACGAGGCAGCCAAGGTCGAGAAGCGGCTGGGCCAGTGA
Gene >Ophcf2|04183
ATGAGCGGATGTCATGTCGCGCTGCAGAAGAGTGCAGTCTCGGATCAATTGCTGACGGAGCGAAGAAACCGGTTA
AGCAACGTCGTCCGGTGGCAAAGCCCATCACCGAAACCGAGTCTGTAGGGTAGGTAGATATCAAAAGCGGGCGCT
CGTGCCGGCAGAGTGACGACCGACGGGCGCACAAGCTCGGGTTGGACGTAACCGCCAATTCATTTCCCTCCCGTA
GCACCGCGATATCTGCCGCTGTCGTCCAACGCCAACGTCAATGCCCCAATAAGCAGGGCCCCGTCCCTATTCCGA
ACGTCCCTGTAAGCCATCCTTACGTATATCCGCAGCCCCGGTCCCGATATCACGGCCCGCCTTACCTCATCAAGT
TCCCGATCCGGCCGAGCGTCGCACCAAGGCCGAGGCCGAGCCGCGAGCCCAAACGCCACGAGAGATCTCTCGAAA
CAAATGGCGGGCAAAAAGGGCGACAACAGCAAGAAGGCAGCCGGCAACGCCCGCAAGGCTGAGGCAGCCGCCAGC
AAAGCGGCAGTCGAGGAGTCACGGCTGGAGGCTGCTGAGGCTGACAAATGGTCCAAGGGGGCAAAGAGTAACGCG
AAGAGGTGCGTATATCTCTCGTCAACGTCGTATCCGCCGTCTCTGACGCCCGTCGGTGATGCAATAGAGAGACGG
AAGCGGCCAAGAAAGCCGAGCAGGCGCGGAAGAAGGCCGAAAAGGACGCCCTCCTCCGCGAGGAAGAGGCATCCA
TCGGCGGCCGCGACGAACCGAAGAAGTCCAAAACACCTGTCAAGAAGTCGCGCGGCCTCGACCTATCACAACTCG
ACGACAACGACAGCCCCGCCGCGACGCTCAACGCCACGGGCATCGACAACGCCCTGGATGCCCTCGATCTCACTG
CCGGCTCCGACGGCACGGCCGCCATCGACAAGCACCCGGAAAAGCGGTTCGCGGCCGCCTACGCAAAGTACGAAG
AGCGCCGTCTGCAGGAGATGAAGGCCGATGGCAGCGGCGTCGGATTGCGCCTCGAACAGCGGAAGCAGAGGATCA
GGAAGGAGTTTGACAAGAGCCCCGAGAACCCCTTCAACCAAGTGACGGCCGCATACAACGCCACAAGAGGCGATG
TAGCAAGTATCCGCAAGGACGAGGCAGCCAAGGTCGAGAAGCGGCTGGGCCAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail