Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04177
Gene name
Locationscaffold_04:1076646..1077952
Strand-
Gene length (bp)1306
Transcript length (bp)1242
Coding sequence length (bp)1242
Protein length (aa) 414

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01266 DAO FAD dependent oxidoreductase 2.7E-59 34 403
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 5.1E-05 35 87

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1743 0.2037 0.0941 0.0418 0.8514 0.1025 0.0366 0.0595 0.0459 0.0961

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5850
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3756
Ophiocordyceps australis map64 (Brazil) OphauB2|2766
Ophiocordyceps camponoti-floridani Ophcf2|04177 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1220
Ophiocordyceps kimflemingae Ophio5|2144

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04177
MASRRRISTTILSPLPSAARFLTTNITPPDFTHVVIGSGIIGLSTARQLTLRPRTSTLLLERHPTAGTETSSRNS
QVLHAGLYYGAQSLKARLCVRGRHLAYGFCRARRVPHARVGKWIVAQDEGQRRRLEDIVGVAGGELGVPLRWLSR
KEVDAKGEGVRALAGALESPETGIVDSHSFMTALHTDFENQGGTTSFRSHVQDIEPLGNNGSSGWRLHVLSEDSP
PTTITTETIINAAGLNATTIHNLIVPASRRLSLHLAKGSYFSYAASRPRISRLVYPAPDARSAGLGTHLTIDLGG
RMRFGPDVEWVNSVDDLSVGTARLSAVADEVRRYLPGLDPSQLVPDYAGIRPKLSRGAALAGGKDFQDFIIRKED
GYEGWVNLLGIESPGLTSCLAIAEMVEQLLYGSVSSTD*
Coding >Ophcf2|04177
ATGGCATCAAGAAGACGAATATCAACAACCATCCTCAGTCCCCTACCATCAGCAGCCCGTTTCCTAACCACCAAC
ATCACCCCCCCTGACTTCACCCACGTGGTGATAGGAAGCGGCATAATCGGCCTCTCCACCGCCCGCCAACTAACC
CTCCGACCCCGAACCTCAACCCTCCTCCTCGAACGCCACCCCACCGCCGGCACAGAAACCAGCTCGCGCAACAGC
CAAGTCCTACACGCCGGCCTCTACTACGGCGCCCAAAGCCTCAAGGCGAGACTATGCGTGCGCGGCCGTCACCTC
GCGTACGGGTTCTGTCGAGCGAGGCGCGTGCCGCACGCCCGCGTGGGGAAATGGATCGTCGCGCAGGATGAGGGT
CAGAGACGGAGACTCGAGGATATCGTCGGCGTTGCTGGCGGAGAACTCGGCGTCCCGCTTCGGTGGCTTTCGCGG
AAGGAGGTTGATGCCAAGGGGGAAGGGGTTAGGGCTTTGGCTGGTGCGCTGGAAAGTCCGGAGACGGGCATCGTC
GATTCGCATTCCTTCATGACCGCTCTACACACCGACTTCGAGAACCAAGGCGGGACAACATCCTTCCGCTCTCAC
GTCCAAGACATCGAACCACTCGGCAACAACGGATCAAGCGGATGGCGTCTTCACGTCCTCTCCGAAGACTCCCCC
CCCACGACGATAACGACAGAAACCATCATCAACGCAGCAGGTCTCAACGCCACCACCATCCACAACCTCATCGTC
CCAGCTTCTCGCCGATTATCCCTTCATCTCGCAAAAGGCTCGTACTTTTCCTACGCTGCTTCCCGGCCGCGCATC
TCGCGCCTCGTCTATCCGGCTCCAGATGCCCGCTCTGCTGGCCTGGGAACCCATCTGACCATCGACCTTGGCGGC
CGCATGCGATTCGGCCCGGATGTCGAATGGGTGAACTCGGTAGATGATCTGTCAGTCGGCACTGCCCGTCTGTCC
GCCGTCGCCGATGAGGTCCGTCGCTACCTCCCCGGACTCGACCCGTCCCAGCTCGTGCCTGATTACGCCGGCATC
CGGCCCAAGCTGAGTCGTGGCGCGGCACTGGCCGGAGGGAAAGACTTTCAGGACTTCATCATCCGCAAGGAGGAC
GGTTACGAGGGCTGGGTCAACTTGCTGGGTATCGAGAGTCCCGGTCTCACCAGCTGCCTTGCCATCGCCGAGATG
GTCGAGCAGCTGTTGTACGGCAGCGTGTCCTCCACCGACTGA
Transcript >Ophcf2|04177
ATGGCATCAAGAAGACGAATATCAACAACCATCCTCAGTCCCCTACCATCAGCAGCCCGTTTCCTAACCACCAAC
ATCACCCCCCCTGACTTCACCCACGTGGTGATAGGAAGCGGCATAATCGGCCTCTCCACCGCCCGCCAACTAACC
CTCCGACCCCGAACCTCAACCCTCCTCCTCGAACGCCACCCCACCGCCGGCACAGAAACCAGCTCGCGCAACAGC
CAAGTCCTACACGCCGGCCTCTACTACGGCGCCCAAAGCCTCAAGGCGAGACTATGCGTGCGCGGCCGTCACCTC
GCGTACGGGTTCTGTCGAGCGAGGCGCGTGCCGCACGCCCGCGTGGGGAAATGGATCGTCGCGCAGGATGAGGGT
CAGAGACGGAGACTCGAGGATATCGTCGGCGTTGCTGGCGGAGAACTCGGCGTCCCGCTTCGGTGGCTTTCGCGG
AAGGAGGTTGATGCCAAGGGGGAAGGGGTTAGGGCTTTGGCTGGTGCGCTGGAAAGTCCGGAGACGGGCATCGTC
GATTCGCATTCCTTCATGACCGCTCTACACACCGACTTCGAGAACCAAGGCGGGACAACATCCTTCCGCTCTCAC
GTCCAAGACATCGAACCACTCGGCAACAACGGATCAAGCGGATGGCGTCTTCACGTCCTCTCCGAAGACTCCCCC
CCCACGACGATAACGACAGAAACCATCATCAACGCAGCAGGTCTCAACGCCACCACCATCCACAACCTCATCGTC
CCAGCTTCTCGCCGATTATCCCTTCATCTCGCAAAAGGCTCGTACTTTTCCTACGCTGCTTCCCGGCCGCGCATC
TCGCGCCTCGTCTATCCGGCTCCAGATGCCCGCTCTGCTGGCCTGGGAACCCATCTGACCATCGACCTTGGCGGC
CGCATGCGATTCGGCCCGGATGTCGAATGGGTGAACTCGGTAGATGATCTGTCAGTCGGCACTGCCCGTCTGTCC
GCCGTCGCCGATGAGGTCCGTCGCTACCTCCCCGGACTCGACCCGTCCCAGCTCGTGCCTGATTACGCCGGCATC
CGGCCCAAGCTGAGTCGTGGCGCGGCACTGGCCGGAGGGAAAGACTTTCAGGACTTCATCATCCGCAAGGAGGAC
GGTTACGAGGGCTGGGTCAACTTGCTGGGTATCGAGAGTCCCGGTCTCACCAGCTGCCTTGCCATCGCCGAGATG
GTCGAGCAGCTGTTGTACGGCAGCGTGTCCTCCACCGACTGA
Gene >Ophcf2|04177
ATGGCATCAAGAAGACGAATATCAACAACCATCCTCAGTCCCCTACCATCAGCAGCCCGTTTCCTAACCACCAAC
ATCACCCCCCCTGACTTCACCCACGTGGTAAGCCAACTTTCACCAATCCCCAAACCAACCCCCCAACGAACAAAG
AAACCAAACAAACCAGGTGATAGGAAGCGGCATAATCGGCCTCTCCACCGCCCGCCAACTAACCCTCCGACCCCG
AACCTCAACCCTCCTCCTCGAACGCCACCCCACCGCCGGCACAGAAACCAGCTCGCGCAACAGCCAAGTCCTACA
CGCCGGCCTCTACTACGGCGCCCAAAGCCTCAAGGCGAGACTATGCGTGCGCGGCCGTCACCTCGCGTACGGGTT
CTGTCGAGCGAGGCGCGTGCCGCACGCCCGCGTGGGGAAATGGATCGTCGCGCAGGATGAGGGTCAGAGACGGAG
ACTCGAGGATATCGTCGGCGTTGCTGGCGGAGAACTCGGCGTCCCGCTTCGGTGGCTTTCGCGGAAGGAGGTTGA
TGCCAAGGGGGAAGGGGTTAGGGCTTTGGCTGGTGCGCTGGAAAGTCCGGAGACGGGCATCGTCGATTCGCATTC
CTTCATGACCGCTCTACACACCGACTTCGAGAACCAAGGCGGGACAACATCCTTCCGCTCTCACGTCCAAGACAT
CGAACCACTCGGCAACAACGGATCAAGCGGATGGCGTCTTCACGTCCTCTCCGAAGACTCCCCCCCCACGACGAT
AACGACAGAAACCATCATCAACGCAGCAGGTCTCAACGCCACCACCATCCACAACCTCATCGTCCCAGCTTCTCG
CCGATTATCCCTTCATCTCGCAAAAGGCTCGTACTTTTCCTACGCTGCTTCCCGGCCGCGCATCTCGCGCCTCGT
CTATCCGGCTCCAGATGCCCGCTCTGCTGGCCTGGGAACCCATCTGACCATCGACCTTGGCGGCCGCATGCGATT
CGGCCCGGATGTCGAATGGGTGAACTCGGTAGATGATCTGTCAGTCGGCACTGCCCGTCTGTCCGCCGTCGCCGA
TGAGGTCCGTCGCTACCTCCCCGGACTCGACCCGTCCCAGCTCGTGCCTGATTACGCCGGCATCCGGCCCAAGCT
GAGTCGTGGCGCGGCACTGGCCGGAGGGAAAGACTTTCAGGACTTCATCATCCGCAAGGAGGACGGTTACGAGGG
CTGGGTCAACTTGCTGGGTATCGAGAGTCCCGGTCTCACCAGCTGCCTTGCCATCGCCGAGATGGTCGAGCAGCT
GTTGTACGGCAGCGTGTCCTCCACCGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail