Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04169
Gene name
Locationscaffold_04:1049691..1051212
Strand-
Gene length (bp)1521
Transcript length (bp)1521
Coding sequence length (bp)1521
Protein length (aa) 507

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05148 Methyltransf_8 Hypothetical methyltransferase 2.4E-56 168 368

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2062 0.7692 0.2173 0.0143 0.048 0.0026 0.0461 0.0085 0.2785 0.0014

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 66.69 38.29 95.08
Alive In ants, during behavior modification 63.41 36.36 90.45
Dead In ants, recently dead 53.09 30.07 76.10

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.831420 no
Alive Dead 0.303603 no
Dead Fungus 0.249818 no

Orthologs

Orthofinder run ID4
Orthogroup1529
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6113
Ophiocordyceps australis map64 (Brazil) OphauB2|3548
Ophiocordyceps camponoti-floridani Ophcf2|04169 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1229
Ophiocordyceps kimflemingae Ophio5|6248
Ophiocordyceps subramaniannii Hirsu2|1122

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04169
MFAVPGWSVSADSLKAEKVPAGDGSETSRSKKRKRAGTSVTAANVVDLYETVFEGKKNKNKKREQPSGDDDGGAK
VRTAKDSQTETKAAKSDKKKKAARPDVKEDANSQLTRHEGDEKSKTEKEAGKQKKQKQQPEPESRDATDSKAPAP
ASQPEPPKQPPAAKLTPLQTSMKEKLVSARFRHLNETLYTRPSAEALRLFDESPDMFDDYHQGFRRQVKVWPENP
VDSFLQDIRARARAKIPAVTKARPGDPPAKRMGNPLPRTAGTCTIADLGCGDARLAESLEAEKLKLRLKLLSYDL
HSVSPMVTRADIAHLPLEDGSINVAIFCLALMGTNWIEFIEEAYRILHWKGELWVAEIKSRFGPVRNAHNPVSHS
VGNRKKTAAKAPRSSEKDGPDAEDLTIEVDGAEDRRHQTDVSAFVEVLRRRGFVLRGEANEAIDLSNRMFVKMHF
VKAAAPMKGKGAKAQEAAVKTTKGAVAKKWLGSGTGDNTEDADEAAILKPCVYKTR*
Coding >Ophcf2|04169
ATGTTTGCTGTACCGGGCTGGTCCGTGTCCGCCGACAGCCTGAAGGCTGAGAAGGTCCCGGCCGGCGACGGGTCA
GAAACGTCCAGATCCAAGAAGCGCAAGAGAGCCGGAACTTCGGTCACGGCGGCTAACGTCGTCGATCTCTACGAG
ACCGTCTTTGAGGGTAAGAAGAATAAGAATAAGAAGAGAGAGCAGCCTTCTGGCGACGATGATGGCGGCGCTAAA
GTCCGGACCGCCAAAGACTCTCAGACGGAGACAAAGGCCGCAAAGTCGGACAAGAAGAAAAAGGCCGCCAGGCCT
GATGTGAAAGAAGACGCAAATTCACAACTCACCCGACACGAAGGCGACGAAAAATCCAAGACAGAGAAAGAAGCG
GGAAAGCAGAAGAAGCAAAAGCAGCAGCCTGAGCCAGAGTCTCGAGATGCCACCGACTCCAAAGCACCGGCACCC
GCGTCACAACCCGAACCTCCAAAGCAACCTCCAGCCGCAAAACTCACGCCCCTGCAGACATCGATGAAGGAAAAG
CTCGTGTCCGCTCGGTTCCGTCACCTCAACGAGACGCTCTATACGCGACCCTCAGCCGAAGCTCTGCGGCTCTTC
GACGAATCTCCCGACATGTTTGATGACTATCATCAGGGCTTCAGGCGGCAGGTCAAGGTCTGGCCTGAGAACCCC
GTCGACAGCTTCCTTCAGGATATCCGCGCCAGGGCTAGGGCGAAGATTCCTGCGGTCACCAAAGCTCGACCCGGC
GACCCCCCGGCCAAGCGGATGGGGAATCCGCTGCCGAGGACGGCTGGCACCTGCACCATCGCTGACCTCGGCTGC
GGAGACGCCCGTCTCGCAGAGTCTCTCGAGGCAGAAAAGCTCAAGCTTCGGCTCAAGCTTTTGAGCTACGACCTC
CACAGCGTCTCCCCCATGGTCACCAGAGCCGACATCGCCCACCTGCCACTGGAAGACGGCTCCATCAACGTCGCC
ATCTTCTGCCTCGCCCTCATGGGCACAAACTGGATTGAGTTCATCGAAGAAGCCTATCGCATCCTCCATTGGAAA
GGCGAGCTCTGGGTCGCCGAGATCAAGAGCCGCTTCGGCCCCGTCCGCAACGCCCATAATCCCGTCTCCCACAGC
GTCGGCAACCGCAAGAAGACCGCCGCCAAGGCTCCGCGCAGCTCCGAGAAAGACGGCCCCGACGCCGAGGATCTG
ACTATCGAGGTCGACGGTGCTGAAGACCGCAGGCACCAGACGGACGTGTCGGCCTTTGTCGAGGTTCTTAGGCGT
AGGGGCTTCGTGCTCCGAGGAGAAGCCAACGAGGCCATCGACCTGTCGAACCGGATGTTCGTCAAGATGCACTTT
GTCAAGGCCGCTGCCCCTATGAAAGGGAAAGGCGCCAAGGCGCAGGAGGCTGCCGTCAAAACAACCAAAGGTGCC
GTCGCCAAGAAGTGGCTTGGGAGCGGCACAGGCGACAATACGGAGGACGCGGATGAGGCAGCCATACTCAAACCT
TGTGTCTACAAGACTCGCTGA
Transcript >Ophcf2|04169
ATGTTTGCTGTACCGGGCTGGTCCGTGTCCGCCGACAGCCTGAAGGCTGAGAAGGTCCCGGCCGGCGACGGGTCA
GAAACGTCCAGATCCAAGAAGCGCAAGAGAGCCGGAACTTCGGTCACGGCGGCTAACGTCGTCGATCTCTACGAG
ACCGTCTTTGAGGGTAAGAAGAATAAGAATAAGAAGAGAGAGCAGCCTTCTGGCGACGATGATGGCGGCGCTAAA
GTCCGGACCGCCAAAGACTCTCAGACGGAGACAAAGGCCGCAAAGTCGGACAAGAAGAAAAAGGCCGCCAGGCCT
GATGTGAAAGAAGACGCAAATTCACAACTCACCCGACACGAAGGCGACGAAAAATCCAAGACAGAGAAAGAAGCG
GGAAAGCAGAAGAAGCAAAAGCAGCAGCCTGAGCCAGAGTCTCGAGATGCCACCGACTCCAAAGCACCGGCACCC
GCGTCACAACCCGAACCTCCAAAGCAACCTCCAGCCGCAAAACTCACGCCCCTGCAGACATCGATGAAGGAAAAG
CTCGTGTCCGCTCGGTTCCGTCACCTCAACGAGACGCTCTATACGCGACCCTCAGCCGAAGCTCTGCGGCTCTTC
GACGAATCTCCCGACATGTTTGATGACTATCATCAGGGCTTCAGGCGGCAGGTCAAGGTCTGGCCTGAGAACCCC
GTCGACAGCTTCCTTCAGGATATCCGCGCCAGGGCTAGGGCGAAGATTCCTGCGGTCACCAAAGCTCGACCCGGC
GACCCCCCGGCCAAGCGGATGGGGAATCCGCTGCCGAGGACGGCTGGCACCTGCACCATCGCTGACCTCGGCTGC
GGAGACGCCCGTCTCGCAGAGTCTCTCGAGGCAGAAAAGCTCAAGCTTCGGCTCAAGCTTTTGAGCTACGACCTC
CACAGCGTCTCCCCCATGGTCACCAGAGCCGACATCGCCCACCTGCCACTGGAAGACGGCTCCATCAACGTCGCC
ATCTTCTGCCTCGCCCTCATGGGCACAAACTGGATTGAGTTCATCGAAGAAGCCTATCGCATCCTCCATTGGAAA
GGCGAGCTCTGGGTCGCCGAGATCAAGAGCCGCTTCGGCCCCGTCCGCAACGCCCATAATCCCGTCTCCCACAGC
GTCGGCAACCGCAAGAAGACCGCCGCCAAGGCTCCGCGCAGCTCCGAGAAAGACGGCCCCGACGCCGAGGATCTG
ACTATCGAGGTCGACGGTGCTGAAGACCGCAGGCACCAGACGGACGTGTCGGCCTTTGTCGAGGTTCTTAGGCGT
AGGGGCTTCGTGCTCCGAGGAGAAGCCAACGAGGCCATCGACCTGTCGAACCGGATGTTCGTCAAGATGCACTTT
GTCAAGGCCGCTGCCCCTATGAAAGGGAAAGGCGCCAAGGCGCAGGAGGCTGCCGTCAAAACAACCAAAGGTGCC
GTCGCCAAGAAGTGGCTTGGGAGCGGCACAGGCGACAATACGGAGGACGCGGATGAGGCAGCCATACTCAAACCT
TGTGTCTACAAGACTCGCTGA
Gene >Ophcf2|04169
ATGTTTGCTGTACCGGGCTGGTCCGTGTCCGCCGACAGCCTGAAGGCTGAGAAGGTCCCGGCCGGCGACGGGTCA
GAAACGTCCAGATCCAAGAAGCGCAAGAGAGCCGGAACTTCGGTCACGGCGGCTAACGTCGTCGATCTCTACGAG
ACCGTCTTTGAGGGTAAGAAGAATAAGAATAAGAAGAGAGAGCAGCCTTCTGGCGACGATGATGGCGGCGCTAAA
GTCCGGACCGCCAAAGACTCTCAGACGGAGACAAAGGCCGCAAAGTCGGACAAGAAGAAAAAGGCCGCCAGGCCT
GATGTGAAAGAAGACGCAAATTCACAACTCACCCGACACGAAGGCGACGAAAAATCCAAGACAGAGAAAGAAGCG
GGAAAGCAGAAGAAGCAAAAGCAGCAGCCTGAGCCAGAGTCTCGAGATGCCACCGACTCCAAAGCACCGGCACCC
GCGTCACAACCCGAACCTCCAAAGCAACCTCCAGCCGCAAAACTCACGCCCCTGCAGACATCGATGAAGGAAAAG
CTCGTGTCCGCTCGGTTCCGTCACCTCAACGAGACGCTCTATACGCGACCCTCAGCCGAAGCTCTGCGGCTCTTC
GACGAATCTCCCGACATGTTTGATGACTATCATCAGGGCTTCAGGCGGCAGGTCAAGGTCTGGCCTGAGAACCCC
GTCGACAGCTTCCTTCAGGATATCCGCGCCAGGGCTAGGGCGAAGATTCCTGCGGTCACCAAAGCTCGACCCGGC
GACCCCCCGGCCAAGCGGATGGGGAATCCGCTGCCGAGGACGGCTGGCACCTGCACCATCGCTGACCTCGGCTGC
GGAGACGCCCGTCTCGCAGAGTCTCTCGAGGCAGAAAAGCTCAAGCTTCGGCTCAAGCTTTTGAGCTACGACCTC
CACAGCGTCTCCCCCATGGTCACCAGAGCCGACATCGCCCACCTGCCACTGGAAGACGGCTCCATCAACGTCGCC
ATCTTCTGCCTCGCCCTCATGGGCACAAACTGGATTGAGTTCATCGAAGAAGCCTATCGCATCCTCCATTGGAAA
GGCGAGCTCTGGGTCGCCGAGATCAAGAGCCGCTTCGGCCCCGTCCGCAACGCCCATAATCCCGTCTCCCACAGC
GTCGGCAACCGCAAGAAGACCGCCGCCAAGGCTCCGCGCAGCTCCGAGAAAGACGGCCCCGACGCCGAGGATCTG
ACTATCGAGGTCGACGGTGCTGAAGACCGCAGGCACCAGACGGACGTGTCGGCCTTTGTCGAGGTTCTTAGGCGT
AGGGGCTTCGTGCTCCGAGGAGAAGCCAACGAGGCCATCGACCTGTCGAACCGGATGTTCGTCAAGATGCACTTT
GTCAAGGCCGCTGCCCCTATGAAAGGGAAAGGCGCCAAGGCGCAGGAGGCTGCCGTCAAAACAACCAAAGGTGCC
GTCGCCAAGAAGTGGCTTGGGAGCGGCACAGGCGACAATACGGAGGACGCGGATGAGGCAGCCATACTCAAACCT
TGTGTCTACAAGACTCGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail