Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04162
Gene name
Locationscaffold_04:1020847..1026207
Strand-
Gene length (bp)5360
Transcript length (bp)4194
Coding sequence length (bp)4194
Protein length (aa) 1398

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04366 Ysc84 Las17-binding protein actin regulator 1.6E-28 158 285
PF00022 Actin Actin 6.0E-15 792 1157

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.6035 0.4153 0.0451 0.1916 0.1866 0.0082 0.2985 0.1029 0.2737 0.0059

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4308
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1001
Ophiocordyceps australis map64 (Brazil) OphauB2|3365
Ophiocordyceps camponoti-floridani Ophcf2|04162 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2077
Ophiocordyceps kimflemingae Ophio5|3021
Ophiocordyceps subramaniannii Hirsu2|884

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04162
MQRVSAFLPSWDKRQSLANKPNNGFFAWTHRNSMPSGSPRTPARINTAAANGLRHQREAFWPGTLDVECEKAARI
LKSFCTDGYLAPQDGPVAPDESPSSPALVPNKIPRPIIQNAAGIAVFSCMRSGLWMTGSGGSGILIARKSDGTWS
PPSGILLHTPTLSFIIGVDIYDCVLVINNLAALESITRPHVTLGEDVGLTNGPSAPLDSDDSSGNWRELGNTVLA
YMKARGQRQSVNLNGCILAERTNENERFYDSSVSQMDILAGNVTRSVDETKPLFEVIKMAEGRSDFDASVIDHIS
LESAPGDAVIATPKTTSAPPRPSFGIPEVDDPDPFGVLALEMAGLEIREAGTRLRPSSSQFEFGAGPLSPALSKF
SRQSVETFATRSNRGSVVSARTAKSHVTDAYTQTDLANTPETSPSPGQSDDGSARDRMPNVKEDDEVDYTRVDLS
PLHNLGRQHSIHFLFADEDAANAPPPSTSAESPAVPGSGEAVLPSAASSMYCTSEDPEETNDADDEDDDDDEVEE
PVVIEVAAVKPASTRAIASRVIQARGNVVTIQKRLPPPLPVRSPARTARVGKTEAAVEVISVPSPLRQAFSDADC
EPQTGDRPASTEEPTDDESEADRTLQDRSVSSEETVAGSVVDHRATTDECTDATEAVDDKAETAAPDDEGSGERD
TQPGDAADRKEQTDTSDSATCGRHTSSIYTGATEDRWSCDGSSLTTPTSERRYSMVGEAKTDTPTKMPREEHVRI
PTRMFRDGDEWRPHHTFKRKRVIDGEEREEWVEDVDSDEGAIYPLEGGRIVDMEAFLAFLDHVHGLLTTTYHNTP
VMLMASPQWTRPDCEAIAQYIFEKTRTPALCLIHSGIATQYGLKWPNMTVIDIGFEKVDVTAIHDGRVVNHTDLG
SPNPDRQISGGEVFTQSLLRLLEGKGFDREMAEQLKRSPVCEVLPYAPAEKTLAELPTEDSVVAEVEGAPDVREE
DGDHEVVVASAEDDEVNDGSGNGDTSNNGNGEDDGVLDVAGIVTSGQTKEFLAKKEKEKEKSKPGRKGKEKESEA
ARSSRLPNSKRRHNVFTYEEIIPDEGQDTSEGEGPRRIRREIDMGIERFTFARRDEIDRIATAIYRTIQGIDEMY
MRPPCWENLVFVGNGSRLRGLKENIVQTLQARHMISPSTATMFTSELPSNMATPTGTGSQTPTGSFTGVPPPPHQ
LSSGVNPLLQAATTASTLAASGLGGQGEMHPQHYHQLAQQQQQQQQQQLQQQLQQQQQQQQPQQPQPQQPQQPQQ
QQQQQQQQQQQIHQLQQLHHFQQQQQQQQQQQQQQHHHQSHFHSQTPTSIKTANLPAYLSEWTKNGFEEAMFLGA
QVAARIAFCLHSNLDAQGVEAQRLMSLGRVDYNELGPKAIRTHSMLG*
Coding >Ophcf2|04162
ATGCAGCGCGTCTCTGCTTTCCTGCCGTCTTGGGACAAGAGGCAGTCTTTGGCCAATAAGCCCAATAATGGATTC
TTCGCCTGGACTCATCGCAATAGCATGCCCTCTGGGTCCCCGAGGACTCCGGCCAGGATCAACACGGCTGCTGCC
AACGGCCTTCGCCATCAGCGTGAGGCTTTTTGGCCCGGTACCCTCGACGTTGAGTGCGAAAAGGCTGCCCGGATT
CTCAAGTCTTTTTGCACCGATGGCTATCTCGCTCCTCAAGACGGCCCCGTCGCCCCCGACGAGTCGCCCTCTTCT
CCCGCCCTCGTCCCCAACAAGATTCCTCGACCCATCATTCAAAACGCCGCCGGTATCGCCGTCTTCTCATGTATG
AGGAGCGGCCTGTGGATGACGGGCTCTGGCGGTTCCGGCATCCTCATCGCCAGAAAGTCCGACGGCACCTGGTCA
CCTCCCTCGGGCATCCTGCTTCACACGCCCACGCTCAGCTTCATCATCGGTGTCGACATTTACGATTGCGTTCTC
GTCATCAATAACCTCGCCGCTCTTGAGTCCATCACCCGCCCGCACGTCACCCTAGGCGAGGATGTCGGCCTCACC
AACGGACCATCGGCGCCTCTCGACTCGGACGACTCCAGTGGCAACTGGAGAGAGCTCGGCAACACCGTCCTCGCC
TATATGAAGGCCAGAGGCCAGCGACAGTCTGTCAATCTCAACGGCTGCATCCTCGCCGAACGCACAAACGAGAAC
GAACGTTTCTACGACAGCTCCGTCTCCCAGATGGACATCTTGGCCGGCAACGTTACCCGCTCCGTCGACGAGACG
AAGCCCCTCTTCGAGGTCATCAAGATGGCCGAGGGCAGGTCCGACTTCGACGCCTCCGTCATCGACCACATCTCC
CTCGAGTCGGCACCCGGCGACGCCGTCATCGCCACGCCCAAGACCACCTCGGCCCCGCCCCGCCCCTCCTTTGGC
ATCCCCGAGGTCGACGACCCGGATCCCTTCGGCGTCTTGGCCCTTGAGATGGCCGGTCTCGAGATCCGCGAAGCT
GGCACGCGCCTGCGGCCTTCGAGTAGCCAGTTCGAGTTTGGTGCCGGCCCGCTGAGTCCGGCGCTGTCCAAGTTC
AGCCGGCAAAGCGTCGAGACATTCGCGACTCGGAGCAACCGCGGCAGCGTCGTGTCTGCCCGCACCGCCAAGAGC
CATGTTACCGACGCCTACACCCAGACGGACCTTGCCAACACGCCCGAGACGTCGCCCAGCCCGGGACAGAGCGAC
GACGGCTCCGCTCGAGACCGCATGCCTAACGTCAAGGAGGACGACGAGGTCGACTACACGCGCGTCGACTTGTCA
CCTCTGCACAACCTCGGCCGTCAGCATTCCATCCATTTCCTTTTCGCCGACGAAGACGCCGCCAACGCACCGCCC
CCGTCGACGTCGGCCGAATCGCCCGCCGTCCCGGGCTCCGGAGAAGCGGTCCTTCCATCGGCAGCCTCCAGCATG
TACTGCACGTCGGAGGATCCGGAGGAGACCAACGATGCCGACGACGAGGACGACGATGACGACGAGGTCGAGGAG
CCCGTCGTCATCGAGGTCGCCGCCGTGAAGCCCGCCAGCACGCGGGCCATCGCCTCTCGCGTCATCCAGGCCCGG
GGCAACGTCGTCACCATCCAGAAGAGGCTGCCCCCTCCTCTTCCCGTTCGGAGCCCTGCCAGGACGGCCCGAGTC
GGAAAAACAGAGGCCGCCGTCGAGGTCATTAGCGTCCCCAGCCCGTTGCGGCAGGCTTTTAGCGATGCCGACTGC
GAGCCCCAAACCGGCGACAGGCCGGCGTCGACCGAGGAGCCGACCGACGACGAGTCAGAAGCGGACAGGACGCTT
CAGGATCGGAGCGTATCCAGCGAGGAGACGGTGGCCGGCAGCGTCGTCGACCACAGGGCGACGACCGACGAGTGC
ACGGACGCCACGGAGGCTGTGGACGACAAGGCAGAGACGGCGGCACCTGACGATGAGGGTAGCGGCGAGCGGGAC
ACGCAGCCGGGAGATGCCGCGGATCGAAAGGAACAGACGGACACATCGGACTCGGCGACGTGTGGGAGGCACACA
TCCTCCATCTATACGGGCGCTACCGAAGACCGCTGGAGCTGCGACGGATCGTCTCTGACGACGCCAACGTCGGAG
CGACGCTATTCCATGGTGGGCGAAGCCAAGACGGACACGCCAACAAAGATGCCACGAGAGGAGCACGTGCGGATC
CCGACGCGCATGTTTCGCGATGGAGACGAGTGGCGGCCTCATCACACGTTTAAGCGGAAGAGGGTCATCGATGGG
GAGGAGCGCGAAGAGTGGGTTGAGGATGTTGATTCGGACGAGGGGGCCATTTATCCGCTAGAGGGCGGTCGTATC
GTTGATATGGAAGCTTTTCTTGCTTTCCTCGACCACGTTCACGGCTTGCTGACGACGACGTACCACAACACGCCC
GTGATGCTGATGGCGTCGCCGCAGTGGACGCGACCCGACTGCGAGGCCATCGCGCAGTACATCTTTGAGAAGACG
CGAACGCCGGCTCTATGCCTGATCCACAGCGGTATCGCGACGCAATACGGCCTCAAGTGGCCCAACATGACAGTC
ATCGACATCGGCTTCGAAAAAGTCGACGTCACCGCCATCCACGACGGCCGCGTCGTCAACCACACCGATCTAGGC
TCGCCCAATCCGGACCGGCAGATAAGCGGCGGGGAGGTGTTTACGCAGAGTTTGCTGCGCTTGCTCGAGGGCAAG
GGCTTTGATCGCGAAATGGCCGAGCAGCTCAAGCGCAGTCCCGTCTGCGAGGTCCTTCCGTATGCGCCGGCGGAG
AAGACGCTTGCCGAGTTGCCGACTGAGGATTCGGTCGTTGCTGAGGTGGAGGGGGCCCCCGATGTGAGGGAGGAG
GATGGGGATCATGAGGTTGTTGTGGCGAGTGCGGAAGATGATGAGGTCAACGACGGCAGTGGGAATGGGGATACG
AGCAATAACGGAAATGGCGAGGACGACGGCGTTCTCGACGTTGCCGGCATCGTCACCAGCGGCCAAACGAAAGAA
TTCCTGGCCAAGAAGGAGAAGGAGAAGGAGAAATCGAAGCCCGGCCGCAAGGGAAAGGAGAAGGAATCAGAGGCA
GCGCGAAGCTCTCGTCTACCCAACAGCAAAAGAAGGCACAACGTCTTTACCTACGAGGAGATCATCCCCGACGAA
GGCCAGGACACCAGCGAAGGCGAAGGACCCCGTCGAATCCGCCGCGAAATCGACATGGGAATCGAACGCTTCACC
TTTGCCCGTCGAGATGAAATCGATAGGATCGCCACGGCAATCTATCGCACCATCCAGGGCATAGACGAAATGTAC
ATGCGCCCACCCTGCTGGGAAAACCTCGTCTTCGTCGGCAACGGGTCACGCCTCCGCGGATTGAAAGAGAACATC
GTCCAGACGCTGCAAGCACGACACATGATTTCGCCATCGACGGCTACCATGTTCACGTCGGAGCTGCCGTCGAAC
ATGGCGACGCCGACGGGGACGGGGAGTCAGACGCCGACGGGGTCGTTTACCGGGGTGCCGCCGCCTCCGCATCAG
CTTTCTTCGGGTGTGAATCCCTTGCTTCAGGCTGCGACTACGGCTTCGACGTTGGCGGCTTCGGGGTTGGGGGGG
CAGGGGGAGATGCATCCTCAGCATTATCATCAGCTTGCCCAGCAGCAGCAGCAGCAGCAGCAGCAGCAACTACAG
CAGCAACTACAGCAGCAGCAACAACAACAACAACCGCAACAACCGCAACCACAACAACCACAACAACCACAACAG
CAGCAGCAGCAGCAGCAGCAGCAACAGCAACAAATCCACCAACTCCAACAACTCCACCACTTCCAACAACAGCAA
CAACAGCAACAGCAACAGCAACAACAACAACACCACCACCAAAGCCACTTCCACTCCCAAACCCCCACGAGCATC
AAGACCGCAAACCTACCAGCCTACCTCTCGGAATGGACCAAGAACGGCTTCGAGGAAGCAATGTTCCTCGGCGCC
CAGGTGGCGGCCAGGATCGCCTTCTGCCTGCATTCTAACCTCGACGCGCAGGGCGTCGAGGCGCAGAGGTTGATG
AGTCTTGGTCGTGTTGATTACAATGAACTGGGACCCAAGGCTATTCGTACGCATTCTATGCTCGGCTAA
Transcript >Ophcf2|04162
ATGCAGCGCGTCTCTGCTTTCCTGCCGTCTTGGGACAAGAGGCAGTCTTTGGCCAATAAGCCCAATAATGGATTC
TTCGCCTGGACTCATCGCAATAGCATGCCCTCTGGGTCCCCGAGGACTCCGGCCAGGATCAACACGGCTGCTGCC
AACGGCCTTCGCCATCAGCGTGAGGCTTTTTGGCCCGGTACCCTCGACGTTGAGTGCGAAAAGGCTGCCCGGATT
CTCAAGTCTTTTTGCACCGATGGCTATCTCGCTCCTCAAGACGGCCCCGTCGCCCCCGACGAGTCGCCCTCTTCT
CCCGCCCTCGTCCCCAACAAGATTCCTCGACCCATCATTCAAAACGCCGCCGGTATCGCCGTCTTCTCATGTATG
AGGAGCGGCCTGTGGATGACGGGCTCTGGCGGTTCCGGCATCCTCATCGCCAGAAAGTCCGACGGCACCTGGTCA
CCTCCCTCGGGCATCCTGCTTCACACGCCCACGCTCAGCTTCATCATCGGTGTCGACATTTACGATTGCGTTCTC
GTCATCAATAACCTCGCCGCTCTTGAGTCCATCACCCGCCCGCACGTCACCCTAGGCGAGGATGTCGGCCTCACC
AACGGACCATCGGCGCCTCTCGACTCGGACGACTCCAGTGGCAACTGGAGAGAGCTCGGCAACACCGTCCTCGCC
TATATGAAGGCCAGAGGCCAGCGACAGTCTGTCAATCTCAACGGCTGCATCCTCGCCGAACGCACAAACGAGAAC
GAACGTTTCTACGACAGCTCCGTCTCCCAGATGGACATCTTGGCCGGCAACGTTACCCGCTCCGTCGACGAGACG
AAGCCCCTCTTCGAGGTCATCAAGATGGCCGAGGGCAGGTCCGACTTCGACGCCTCCGTCATCGACCACATCTCC
CTCGAGTCGGCACCCGGCGACGCCGTCATCGCCACGCCCAAGACCACCTCGGCCCCGCCCCGCCCCTCCTTTGGC
ATCCCCGAGGTCGACGACCCGGATCCCTTCGGCGTCTTGGCCCTTGAGATGGCCGGTCTCGAGATCCGCGAAGCT
GGCACGCGCCTGCGGCCTTCGAGTAGCCAGTTCGAGTTTGGTGCCGGCCCGCTGAGTCCGGCGCTGTCCAAGTTC
AGCCGGCAAAGCGTCGAGACATTCGCGACTCGGAGCAACCGCGGCAGCGTCGTGTCTGCCCGCACCGCCAAGAGC
CATGTTACCGACGCCTACACCCAGACGGACCTTGCCAACACGCCCGAGACGTCGCCCAGCCCGGGACAGAGCGAC
GACGGCTCCGCTCGAGACCGCATGCCTAACGTCAAGGAGGACGACGAGGTCGACTACACGCGCGTCGACTTGTCA
CCTCTGCACAACCTCGGCCGTCAGCATTCCATCCATTTCCTTTTCGCCGACGAAGACGCCGCCAACGCACCGCCC
CCGTCGACGTCGGCCGAATCGCCCGCCGTCCCGGGCTCCGGAGAAGCGGTCCTTCCATCGGCAGCCTCCAGCATG
TACTGCACGTCGGAGGATCCGGAGGAGACCAACGATGCCGACGACGAGGACGACGATGACGACGAGGTCGAGGAG
CCCGTCGTCATCGAGGTCGCCGCCGTGAAGCCCGCCAGCACGCGGGCCATCGCCTCTCGCGTCATCCAGGCCCGG
GGCAACGTCGTCACCATCCAGAAGAGGCTGCCCCCTCCTCTTCCCGTTCGGAGCCCTGCCAGGACGGCCCGAGTC
GGAAAAACAGAGGCCGCCGTCGAGGTCATTAGCGTCCCCAGCCCGTTGCGGCAGGCTTTTAGCGATGCCGACTGC
GAGCCCCAAACCGGCGACAGGCCGGCGTCGACCGAGGAGCCGACCGACGACGAGTCAGAAGCGGACAGGACGCTT
CAGGATCGGAGCGTATCCAGCGAGGAGACGGTGGCCGGCAGCGTCGTCGACCACAGGGCGACGACCGACGAGTGC
ACGGACGCCACGGAGGCTGTGGACGACAAGGCAGAGACGGCGGCACCTGACGATGAGGGTAGCGGCGAGCGGGAC
ACGCAGCCGGGAGATGCCGCGGATCGAAAGGAACAGACGGACACATCGGACTCGGCGACGTGTGGGAGGCACACA
TCCTCCATCTATACGGGCGCTACCGAAGACCGCTGGAGCTGCGACGGATCGTCTCTGACGACGCCAACGTCGGAG
CGACGCTATTCCATGGTGGGCGAAGCCAAGACGGACACGCCAACAAAGATGCCACGAGAGGAGCACGTGCGGATC
CCGACGCGCATGTTTCGCGATGGAGACGAGTGGCGGCCTCATCACACGTTTAAGCGGAAGAGGGTCATCGATGGG
GAGGAGCGCGAAGAGTGGGTTGAGGATGTTGATTCGGACGAGGGGGCCATTTATCCGCTAGAGGGCGGTCGTATC
GTTGATATGGAAGCTTTTCTTGCTTTCCTCGACCACGTTCACGGCTTGCTGACGACGACGTACCACAACACGCCC
GTGATGCTGATGGCGTCGCCGCAGTGGACGCGACCCGACTGCGAGGCCATCGCGCAGTACATCTTTGAGAAGACG
CGAACGCCGGCTCTATGCCTGATCCACAGCGGTATCGCGACGCAATACGGCCTCAAGTGGCCCAACATGACAGTC
ATCGACATCGGCTTCGAAAAAGTCGACGTCACCGCCATCCACGACGGCCGCGTCGTCAACCACACCGATCTAGGC
TCGCCCAATCCGGACCGGCAGATAAGCGGCGGGGAGGTGTTTACGCAGAGTTTGCTGCGCTTGCTCGAGGGCAAG
GGCTTTGATCGCGAAATGGCCGAGCAGCTCAAGCGCAGTCCCGTCTGCGAGGTCCTTCCGTATGCGCCGGCGGAG
AAGACGCTTGCCGAGTTGCCGACTGAGGATTCGGTCGTTGCTGAGGTGGAGGGGGCCCCCGATGTGAGGGAGGAG
GATGGGGATCATGAGGTTGTTGTGGCGAGTGCGGAAGATGATGAGGTCAACGACGGCAGTGGGAATGGGGATACG
AGCAATAACGGAAATGGCGAGGACGACGGCGTTCTCGACGTTGCCGGCATCGTCACCAGCGGCCAAACGAAAGAA
TTCCTGGCCAAGAAGGAGAAGGAGAAGGAGAAATCGAAGCCCGGCCGCAAGGGAAAGGAGAAGGAATCAGAGGCA
GCGCGAAGCTCTCGTCTACCCAACAGCAAAAGAAGGCACAACGTCTTTACCTACGAGGAGATCATCCCCGACGAA
GGCCAGGACACCAGCGAAGGCGAAGGACCCCGTCGAATCCGCCGCGAAATCGACATGGGAATCGAACGCTTCACC
TTTGCCCGTCGAGATGAAATCGATAGGATCGCCACGGCAATCTATCGCACCATCCAGGGCATAGACGAAATGTAC
ATGCGCCCACCCTGCTGGGAAAACCTCGTCTTCGTCGGCAACGGGTCACGCCTCCGCGGATTGAAAGAGAACATC
GTCCAGACGCTGCAAGCACGACACATGATTTCGCCATCGACGGCTACCATGTTCACGTCGGAGCTGCCGTCGAAC
ATGGCGACGCCGACGGGGACGGGGAGTCAGACGCCGACGGGGTCGTTTACCGGGGTGCCGCCGCCTCCGCATCAG
CTTTCTTCGGGTGTGAATCCCTTGCTTCAGGCTGCGACTACGGCTTCGACGTTGGCGGCTTCGGGGTTGGGGGGG
CAGGGGGAGATGCATCCTCAGCATTATCATCAGCTTGCCCAGCAGCAGCAGCAGCAGCAGCAGCAGCAACTACAG
CAGCAACTACAGCAGCAGCAACAACAACAACAACCGCAACAACCGCAACCACAACAACCACAACAACCACAACAG
CAGCAGCAGCAGCAGCAGCAGCAACAGCAACAAATCCACCAACTCCAACAACTCCACCACTTCCAACAACAGCAA
CAACAGCAACAGCAACAGCAACAACAACAACACCACCACCAAAGCCACTTCCACTCCCAAACCCCCACGAGCATC
AAGACCGCAAACCTACCAGCCTACCTCTCGGAATGGACCAAGAACGGCTTCGAGGAAGCAATGTTCCTCGGCGCC
CAGGTGGCGGCCAGGATCGCCTTCTGCCTGCATTCTAACCTCGACGCGCAGGGCGTCGAGGCGCAGAGGTTGATG
AGTCTTGGTCGTGTTGATTACAATGAACTGGGACCCAAGGCTATTCGTACGCATTCTATGCTCGGCTAA
Gene >Ophcf2|04162
ATGCAGCGCGTCTCTGCTTTCCTGCCGTCTTGGGACAAGAGGCAGTCTTTGGCCAATAAGCCCAATAATGGATTC
TTCGCCTGGACTCATCGCAATAGCATGCCCTCTGGGTCCCCGAGGACTCCGGCCAGGATCAACACGGCTGCTGCC
AACGGCCTTCGCCATCAGCGTGAGGCTTTTTGGCCCGGTACCCTCGACGTTGAGTGCGAAAAGGCTGCCCGGATT
CTCAAGTCTTTTTGCAGTGCGTTGAGAAGATTCATCCCGAAATCATACCTGATTTGGCTGCTGACCTCTTCCAGC
CGATGGCTATCTCGCTCCTCAAGACGGCCCCGTCGCCCCCGACGAGTCGCCCTCTTCTCCCGCCCTCGTCCCCAA
CAAGATTCCTCGACCCATCATTCAAAACGCCGCCGGTATCGCCGTCTTCTCATGTATGAGGAGCGGCCTGTGGAT
GACGGGCTCTGGCGGTTCCGGCATCCTCATCGCCAGAAAGTCCGACGGCACCTGGTCACCTCCCTCGGGCATCCT
GCTTCACACGCCCACGCTCAGCTTCATCATCGGTGTCGACATTTACGATTGCGTTCTCGTCATCAATAACCTCGC
CGCTCTTGAGTCCATCACCCGCCCGCACGTCACCCTAGGCGAGGATGTCGGCCTCACCAACGGACCATCGGCGCC
TCTCGACTCGGACGACTCCAGTGGCAACTGGAGAGAGCTCGGCAACACCGTCCTCGCCTATATGAAGGCCAGAGG
CCAGCGACAGTCTGTCAATCTCAACGGCTGCATCCTCGCCGAACGCACAAACGAGAACGAACGTTTCTACGACAG
CTCCGTCTCCCAGATGGACATCTTGGCCGGCAACGTTACCCGCTCCGTCGACGAGACGAAGCCCCTCTTCGAGGT
CATCAAGATGGCCGAGGGCAGGTCCGACTTCGACGCCTCCGTCATCGACCACATCTCCCTCGAGTCGGCACCCGG
CGACGCCGTCATCGCCACGCCCAAGACCACCTCGGCCCCGCCCCGCCCCTCCTTTGGCATCCCCGAGGTCGACGA
CCCGGATCCCTTCGGCGTCTTGGCCCTTGAGATGGCCGGTCTCGAGATCCGCGAAGCTGGCACGCGCCTGCGGCC
TTCGAGTAGCCAGTTCGAGTTTGGTGCCGGCCCGCTGAGTCCGGCGCTGTCCAAGTTCAGCCGGCAAAGCGTCGA
GACATTCGCGACTCGGAGCAACCGCGGCAGCGTCGTGTCTGCCCGCACCGCCAAGAGCCATGTTACCGACGCCTA
CACCCAGACGGACCTTGCCAACACGCCCGAGACGTCGCCCAGCCCGGGACAGAGCGACGACGGCTCCGCTCGAGA
CCGCATGCCTAACGTCAAGGAGGACGACGAGGTCGACTACACGCGCGTCGACTTGTCACCTCTGCACAACCTCGG
CCGTCAGCATTCCATCCATTTCCTTTTCGCCGACGAAGACGCCGCCAACGCACCGCCCCCGTCGACGTCGGCCGA
ATCGCCCGCCGTCCCGGGCTCCGGAGAAGCGGTCCTTCCATCGGCAGCCTCCAGCATGTACTGCACGTCGGAGGA
TCCGGAGGAGACCAACGATGCCGACGACGAGGACGACGATGACGACGAGGTCGAGGAGCCCGTCGTCATCGAGGT
CGCCGCCGTGAAGCCCGCCAGCACGCGGGCCATCGCCTCTCGCGTCATCCAGGCCCGGGGCAACGTCGTCACCAT
CCAGAAGAGGCTGCCCCCTCCTCTTCCCGTTCGGAGCCCTGCCAGGACGGCCCGAGTCGGAAAAACAGAGGCCGC
CGTCGAGGTCATTAGCGTCCCCAGCCCGTTGCGGCAGGCTTTTAGCGATGCCGACTGCGAGCCCCAAACCGGCGA
CAGGCCGGCGTCGACCGAGGAGCCGACCGACGACGAGTCAGAAGCGGACAGGACGCTTCAGGATCGGAGCGTATC
CAGCGAGGAGACGGTGGCCGGCAGCGTCGTCGACCACAGGGCGACGACCGACGAGTGCACGGACGCCACGGAGGC
TGTGGACGACAAGGCAGAGACGGCGGCACCTGACGATGAGGGTAGCGGCGAGCGGGACACGCAGCCGGGAGATGC
CGCGGATCGAAAGGAACAGACGGACACATCGGACTCGGCGACGTGTGGGAGGCACACATCCTCCATCTATACGGG
CGCTACCGAAGACCGCTGGAGCTGCGACGGATCGTCTCTGACGACGCCAACGTCGGAGCGACGCTATTCCATGGT
GGGCGAAGCCAAGACGGACACGCCAACAAAGATGCCACGAGAGGAGCACGTGGTGGGTAAGACGTCGCCACGAGC
AGCAGCGGCGCCGACGCCAACGCCAGCCCTTGTCGCCACGAGATGACGAAACCCGTTTATTCTTCTTACATCATT
GTCTACTTTCTTTTCTTTTCATTTTAATGCGTCGCGCCCTTCGTCTACGACGGCGAGGAGCACGGCCTTGAAGGA
TTGACGGTTCACACGAAAATCTGGATTTATCATTCACGGTTCGCCTTGGAGCGGGCCTTATACCTTCGTGTCGAT
AGGTTTTCGGAGGCGCCTGCTCGGTCGAGATAAGACGGCCGCGGTGTACCATATGGGACTGGCTTTGGGGAAGGG
GGGAAAGGGGGATGACGTGGATGGAATTGCTTGCGAGGCGGCGTTTGGAAAGGAACCCCGGCTTCGGACCCGGAT
GTCGACACGATTTTCTACGACGGCGGGGAGTCGGTGATGGCCGGTGGTAATGGCTGTCCGGATAGACGGGGTGTA
TATAGACTGGTTGGGGGGGTGGTGGTTCCGGCTTTGGAGCCGGGGCGTATATATCGAGACTGAGCCTGGTGGCCA
CTGGCTGTCGGTCTGTCTTGTTACGAAGTAGATTTGTGCGGTGGAGATTTGTGTGAGTATGTATGTCCCGAAGCC
TGTGGACAGGAGGTTTGTTGGGTGTTGTCGTTGACGTTGTCCTTGGAGTTGAAGAAGTGGATCGATCGGGTGAGT
AAGAGGTCACGTGAGCGACGCGTTTTCTTGGACGCGAGCCTCATCGTCGGTTCGAACGACGGACACGATTAATCG
ATAAAGCAGCGAGGCCCAGCCCTAGGCAATTCCAAGGCACGCAATCGTCGTATCAGCATCCGAGGGTAGATCTTG
GGATGGCCAGCTCAGCGGCTAAGTGGCGCGAGGAGCAGATCCTCATCATCTGCCCGGGCAGCCGGACGACGATGG
CGCAGCTAGGATGCGGCGAGTTGACGCCTCCGACGCAGCGGATCCCGACGCGCATGTTTCGCGATGGAGACGAGT
GGCGGCCTCATCACACGTTTAAGCGGAAGAGGGTCATCGATGGGGAGGAGCGCGAAGAGTGGGTTGAGGATGTTG
ATTCGGACGAGGGGGCCATTTATCCGCTAGAGGGTTCGTCTGAGGCCGTCCTCTCGTTGACATGTTGATTTTTGA
CTCGGACGATATAGGCGGTCGTATCGTTGATATGGAAGCTTTTCTTGCTTTCCTCGACCACGTTCACGGCTTGCT
GACGACGACGTACCACAACACGCCCGTGATGCTGATGGCGTCGCCGCAGTGGACGCGACCCGACTGCGAGGCCAT
CGCGCAGTACATCTTTGAGAAGACGCGAACGCCGGCTCTATGCCTGATCCACAGCGGTATCGCGACGCAATACGG
CCTCAAGTGGCCCAACATGACAGTCATCGACATCGGCTTCGAAAAAGTCGACGTCACCGCCATCCACGACGGCCG
CGTCGTCAACCACACCGATCTAGGCTCGCCCAATCCGGACCGGCAGATAAGCGGCGGGGAGGTGTTTACGCAGAG
TTTGCTGCGCTTGCTCGAGGGCAAGGGCTTTGATCGCGAAATGGCCGAGCAGCTCAAGCGCAGTCCCGTCTGCGA
GGTCCTTCCGTATGCGCCGGCGGAGAAGACGCTTGCCGAGTTGCCGACTGAGGATTCGGTCGTTGCTGAGGTGGA
GGGGGCCCCCGATGTGAGGGAGGAGGATGGGGATCATGAGGTTGTTGTGGCGAGTGCGGAAGATGATGAGGTCAA
CGACGGCAGTGGGAATGGGGATACGAGCAATAACGGAAATGGCGAGGACGACGGCGTTCTCGACGTTGCCGGCAT
CGTCACCAGCGGCCAAACGAAAGAATTCCTGGCCAAGAAGGAGAAGGAGAAGGAGAAATCGAAGCCCGGCCGCAA
GGGAAAGGAGAAGGAATCAGAGGCAGCGCGAAGCTCTCGTCTACCCAACAGCAAAAGAAGGCACAACGTCTTTAC
CTACGAGGAGATCATCCCCGACGAAGGCCAGGACACCAGCGAAGGCGAAGGACCCCGTCGAATCCGCCGCGAAAT
CGACATGGGAATCGAACGCTTCACCTTTGCCCGTCGAGATGAAATCGATAGGATCGCCACGGCAATCTATCGCAC
CATCCAGGGCATAGACGAAATGTACATGCGCCCACCCTGCTGGGAAAACCTCGTCTTCGTCGGCAACGGGTCACG
CCTCCGCGGATTGAAAGAGAACATCGTCCAGACGCTGCAAGCACGACACATGATTTCGCCATCGACGGCTACCAT
GTTCACGTCGGAGCTGCCGTCGAACATGGCGACGCCGACGGGGACGGGGAGTCAGACGCCGACGGGGTCGTTTAC
CGGGGTGCCGCCGCCTCCGCATCAGCTTTCTTCGGGTGTGAATCCCTTGCTTCAGGCTGCGACTACGGCTTCGAC
GTTGGCGGCTTCGGGGTTGGGGGGGCAGGGGGAGATGCATCCTCAGCATTATCATCAGCTTGCCCAGCAGCAGCA
GCAGCAGCAGCAGCAGCAACTACAGCAGCAACTACAGCAGCAGCAACAACAACAACAACCGCAACAACCGCAACC
ACAACAACCACAACAACCACAACAGCAGCAGCAGCAGCAGCAGCAGCAACAGCAACAAATCCACCAACTCCAACA
ACTCCACCACTTCCAACAACAGCAACAACAGCAACAGCAACAGCAACAACAACAACACCACCACCAAAGCCACTT
CCACTCCCAAACCCCCACGAGCATCAAGACCGCAAACCTACCAGCCTACCTCTCGGAATGGACCAAGAACGGCTT
CGAGGAAGCAATGTTCCTCGGCGCCCAGGTGGCGGCCAGGATCGCCTTCTGCCTGCATTCTAACCTCGACGCGCA
GGGCGTCGAGGCGCAGAGGTTGATGAGTCTTGGTCGTGTTGATTACAAGTTTGTCTACCTTCCCCCCCCCCCCCC
CCTTCCTTCTTTCTTTTCTTTTCTTTTCTGTCGTGACGTGTCGGTGACTGACCGGGGTTGATAGTGAACTGGGAC
CCAAGGCTATTCGTACGCATTCTATGCTCGGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail