Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04156
Gene name
Locationscaffold_04:1006496..1008625
Strand-
Gene length (bp)2129
Transcript length (bp)2073
Coding sequence length (bp)2073
Protein length (aa) 691

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04851 ResIII Type III restriction enzyme, res subunit 1.6E-24 39 201
PF00271 Helicase_C Helicase conserved C-terminal domain 1.5E-13 281 378
PF00270 DEAD DEAD/DEAH box helicase 2.8E-11 44 204

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0003676 nucleic acid binding Yes
GO:0003677 DNA binding Yes
GO:0016787 hydrolase activity Yes
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0030554 adenyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.0983 0.1772 0.1059 0.0686 0.8503 0.0508 0.0265 0.0496 0.0511 0.0121

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2520
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4430
Ophiocordyceps australis map64 (Brazil) OphauB2|1165
Ophiocordyceps camponoti-floridani Ophcf2|04156 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2157
Ophiocordyceps kimflemingae Ophio5|3013
Ophiocordyceps subramaniannii Hirsu2|3685

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04156
MLRITAGSLFRPRLALRIRVPKPFIILRVPAATLATDEKLKLRDYQQECIDTVLSSLEKGHKRVGISLATGSGKT
VVFTQLIDKIPPRPNHGDQTLILAHRRELVEQAARQCLRAYPEKSIEIEMGSLHASGAADITVASVQSITSKDRL
DKFDPSSFKLVLVDEAHHIVSPGYLRALEYFGLGRKQLDSPTLVGVSATFSRFDGLKLGVAIDEIVFHRDYVDMI
SDKWLSDVLFTTVRSSADLAHVKRGVFGDFHTGDLSNAVNTREVNELTVRSWMAKASDRKSTLVFCVDLEHVRGL
TEAFRQVGLDARFVTGETPKLERSETLESFKSGGFPVLVNCGVFTEGTDIPNVDCIVLARPTRSRNLLVQMIGRG
MRLSPGKENCHVIDLVSSLETGIVTTPTLFGLDPSELVEKASVDDLRHIKDLVEQAKERDAARIREAALLEADND
DVDDDASPDSHNDVEDSRSPPASVTFTDYNSVLDLVADTSKSKWIRSISPNAWVRTAENRYILASPKGDTLRIEL
SEATPIEDPDPDADSDADPETDPDADYDDLEQPPPPPTPPNTAPSTTAPSATSQPPPAKTAVHGADNWAAHNFPR
TFISHSQPWRRLPATEGQLSFLNRFRGDADQLLPEDLSKGKAADMITRIKYGARGQFSKMKGEIRRREKKAGVEA
QRKAREMVQVGPLQR*
Coding >Ophcf2|04156
ATGCTGCGCATCACTGCCGGCAGCCTCTTCCGTCCGCGCCTCGCCCTCCGCATAAGAGTCCCGAAGCCATTCATC
ATCCTTCGAGTCCCTGCAGCGACGCTGGCGACAGACGAGAAGCTCAAGCTTAGAGACTACCAGCAAGAATGCATC
GACACGGTCCTCTCCTCTCTCGAAAAAGGCCATAAGCGCGTGGGAATATCCCTCGCGACTGGAAGCGGCAAGACA
GTCGTCTTCACGCAACTCATTGACAAGATCCCCCCTCGCCCCAACCATGGCGACCAGACGCTCATCCTCGCCCAT
CGAAGGGAACTCGTCGAGCAGGCCGCGCGTCAATGCCTGAGAGCGTATCCCGAGAAATCGATTGAGATCGAGATG
GGCTCGCTCCATGCTTCGGGCGCGGCCGACATTACCGTCGCCAGCGTGCAGAGCATCACGTCCAAAGATCGGCTC
GACAAGTTCGATCCCTCGTCGTTTAAGCTGGTGCTCGTTGACGAAGCTCATCACATCGTCTCTCCCGGCTACCTG
CGAGCACTCGAATACTTCGGTCTCGGACGGAAACAGCTCGACTCCCCCACCCTCGTCGGCGTCTCAGCCACCTTT
TCCCGCTTCGACGGCCTCAAGCTGGGCGTCGCCATCGACGAAATCGTCTTCCACAGGGATTACGTCGACATGATA
TCCGACAAGTGGCTCTCCGACGTCCTCTTCACCACCGTCCGCTCCTCGGCCGACCTGGCCCACGTCAAGCGCGGT
GTCTTTGGAGATTTCCATACAGGCGACCTCTCCAACGCCGTCAACACGCGCGAAGTCAACGAGCTAACAGTCCGA
AGCTGGATGGCCAAAGCCTCGGATCGCAAGTCAACGCTCGTCTTCTGCGTCGATCTAGAGCACGTCCGCGGCCTC
ACCGAAGCCTTCCGCCAAGTCGGTCTCGACGCCCGCTTCGTAACAGGCGAGACACCCAAGCTAGAACGCAGCGAG
ACGCTCGAATCCTTCAAGAGCGGCGGCTTCCCCGTCCTCGTCAACTGCGGCGTCTTCACCGAGGGAACCGACATC
CCAAACGTCGACTGCATCGTCCTCGCCCGTCCGACACGCTCGCGCAACCTCCTAGTCCAGATGATCGGTCGAGGC
ATGCGTCTATCCCCGGGCAAAGAAAACTGTCACGTCATCGATTTAGTCTCCAGCCTTGAAACCGGCATCGTCACC
ACCCCAACCCTCTTCGGCCTCGATCCCAGCGAACTAGTGGAAAAGGCGTCCGTCGACGACCTCCGCCACATCAAA
GATCTCGTCGAACAAGCCAAAGAGCGCGACGCAGCCCGCATCCGAGAAGCGGCCCTCTTGGAAGCCGACAACGAC
GACGTCGACGACGACGCCAGCCCAGATTCCCACAACGACGTCGAGGACTCCCGCTCCCCTCCCGCATCCGTCACC
TTTACGGACTACAACTCCGTCCTCGACCTCGTGGCCGACACCTCAAAGAGCAAATGGATCCGCTCCATCAGCCCA
AACGCCTGGGTCCGCACAGCCGAGAACCGCTACATCCTCGCCTCCCCAAAAGGCGACACCCTCCGCATCGAACTC
TCGGAAGCCACCCCAATCGAAGACCCCGATCCCGACGCCGACTCCGACGCCGACCCCGAAACCGACCCCGATGCC
GACTACGACGACCTCGAACAACCCCCCCCCCCCCCAACCCCCCCCAATACCGCGCCCTCTACTACCGCTCCCTCC
GCAACTTCACAACCCCCGCCGGCCAAAACCGCCGTCCACGGCGCCGACAACTGGGCCGCCCACAACTTCCCCCGG
ACCTTCATCTCCCACTCCCAACCCTGGCGCCGCCTCCCCGCAACAGAAGGCCAGCTCTCCTTCCTCAACCGCTTC
CGCGGCGACGCCGACCAGCTCCTCCCCGAGGACCTCTCCAAGGGCAAGGCCGCCGACATGATCACGAGGATCAAG
TACGGCGCCCGCGGGCAGTTTTCCAAAATGAAGGGCGAGATCAGGCGGAGGGAGAAGAAGGCTGGCGTTGAGGCT
CAGAGGAAGGCGAGGGAGATGGTTCAGGTTGGGCCTCTTCAGCGGTAG
Transcript >Ophcf2|04156
ATGCTGCGCATCACTGCCGGCAGCCTCTTCCGTCCGCGCCTCGCCCTCCGCATAAGAGTCCCGAAGCCATTCATC
ATCCTTCGAGTCCCTGCAGCGACGCTGGCGACAGACGAGAAGCTCAAGCTTAGAGACTACCAGCAAGAATGCATC
GACACGGTCCTCTCCTCTCTCGAAAAAGGCCATAAGCGCGTGGGAATATCCCTCGCGACTGGAAGCGGCAAGACA
GTCGTCTTCACGCAACTCATTGACAAGATCCCCCCTCGCCCCAACCATGGCGACCAGACGCTCATCCTCGCCCAT
CGAAGGGAACTCGTCGAGCAGGCCGCGCGTCAATGCCTGAGAGCGTATCCCGAGAAATCGATTGAGATCGAGATG
GGCTCGCTCCATGCTTCGGGCGCGGCCGACATTACCGTCGCCAGCGTGCAGAGCATCACGTCCAAAGATCGGCTC
GACAAGTTCGATCCCTCGTCGTTTAAGCTGGTGCTCGTTGACGAAGCTCATCACATCGTCTCTCCCGGCTACCTG
CGAGCACTCGAATACTTCGGTCTCGGACGGAAACAGCTCGACTCCCCCACCCTCGTCGGCGTCTCAGCCACCTTT
TCCCGCTTCGACGGCCTCAAGCTGGGCGTCGCCATCGACGAAATCGTCTTCCACAGGGATTACGTCGACATGATA
TCCGACAAGTGGCTCTCCGACGTCCTCTTCACCACCGTCCGCTCCTCGGCCGACCTGGCCCACGTCAAGCGCGGT
GTCTTTGGAGATTTCCATACAGGCGACCTCTCCAACGCCGTCAACACGCGCGAAGTCAACGAGCTAACAGTCCGA
AGCTGGATGGCCAAAGCCTCGGATCGCAAGTCAACGCTCGTCTTCTGCGTCGATCTAGAGCACGTCCGCGGCCTC
ACCGAAGCCTTCCGCCAAGTCGGTCTCGACGCCCGCTTCGTAACAGGCGAGACACCCAAGCTAGAACGCAGCGAG
ACGCTCGAATCCTTCAAGAGCGGCGGCTTCCCCGTCCTCGTCAACTGCGGCGTCTTCACCGAGGGAACCGACATC
CCAAACGTCGACTGCATCGTCCTCGCCCGTCCGACACGCTCGCGCAACCTCCTAGTCCAGATGATCGGTCGAGGC
ATGCGTCTATCCCCGGGCAAAGAAAACTGTCACGTCATCGATTTAGTCTCCAGCCTTGAAACCGGCATCGTCACC
ACCCCAACCCTCTTCGGCCTCGATCCCAGCGAACTAGTGGAAAAGGCGTCCGTCGACGACCTCCGCCACATCAAA
GATCTCGTCGAACAAGCCAAAGAGCGCGACGCAGCCCGCATCCGAGAAGCGGCCCTCTTGGAAGCCGACAACGAC
GACGTCGACGACGACGCCAGCCCAGATTCCCACAACGACGTCGAGGACTCCCGCTCCCCTCCCGCATCCGTCACC
TTTACGGACTACAACTCCGTCCTCGACCTCGTGGCCGACACCTCAAAGAGCAAATGGATCCGCTCCATCAGCCCA
AACGCCTGGGTCCGCACAGCCGAGAACCGCTACATCCTCGCCTCCCCAAAAGGCGACACCCTCCGCATCGAACTC
TCGGAAGCCACCCCAATCGAAGACCCCGATCCCGACGCCGACTCCGACGCCGACCCCGAAACCGACCCCGATGCC
GACTACGACGACCTCGAACAACCCCCCCCCCCCCCAACCCCCCCCAATACCGCGCCCTCTACTACCGCTCCCTCC
GCAACTTCACAACCCCCGCCGGCCAAAACCGCCGTCCACGGCGCCGACAACTGGGCCGCCCACAACTTCCCCCGG
ACCTTCATCTCCCACTCCCAACCCTGGCGCCGCCTCCCCGCAACAGAAGGCCAGCTCTCCTTCCTCAACCGCTTC
CGCGGCGACGCCGACCAGCTCCTCCCCGAGGACCTCTCCAAGGGCAAGGCCGCCGACATGATCACGAGGATCAAG
TACGGCGCCCGCGGGCAGTTTTCCAAAATGAAGGGCGAGATCAGGCGGAGGGAGAAGAAGGCTGGCGTTGAGGCT
CAGAGGAAGGCGAGGGAGATGGTTCAGGTTGGGCCTCTTCAGCGGTAG
Gene >Ophcf2|04156
ATGCTGCGCATCACTGCCGGCAGCCTCTTCCGTCCGCGCCTCGCCCTCCGCATAAGAGTCCCGAAGCCATTCATC
ATCCTTCGAGTCCCTGCAGCGACGCTGGCGACAGACGAGAAGCTCAAGCTTAGAGACTACCAGCAAGAATGCATC
GACACGGTCCTCTCCTCTCTCGAAAAAGGCCATAAGCGCGTGGGAATATCCCTCGCGACTGGAAGCGGCAAGACA
GTCGTCTTCACGCAACTCATTGACAAGATCCCCCCTCGCCCCAACCATGGCGACCAGACGCTCATCCTCGCCCAT
CGAAGGGAACTCGTCGAGCAGGCCGCGCGTCAATGCCTGAGAGCGTATCCCGAGAAATCGATTGAGATCGAGATG
GGCTCGCTCCATGCTTCGGGCGCGGCCGACATTACCGTCGCCAGCGTGCAGAGCATCACGTCCAAAGATCGGCTC
GACAAGTTCGATCCCTCGTCGTTTAAGCTGGTGCTCGTTGACGAAGCTCATCACATCGTCTCTCCCGGCTACCTG
CGAGCACTCGAATACTTCGGTCTCGGACGGAAACAGCTCGACTCCCCCACCCTCGTCGGCGTCTCAGCCACCTTT
TCCCGCTTCGACGGCCTCAAGCTGGGCGTCGCCATCGACGAAATCGTCTTCCACAGGGATTACGTCGACATGATA
TCCGACAAGTGGCTCTCCGACGTCCTCTTCACCACCGTCCGCTCCTCGGCCGACCTGGCCCACGTCAAGCGCGGT
GTCTTTGGAGATTTCCATACAGGCGACCTCTCCAACGCCGTCAACACGCGCGAAGTCAACGAGCTAACAGTCCGA
AGCTGGATGGCCAAAGCCTCGGATCGCAAGTCAACGCTCGTCTTCTGCGTCGATCTAGAGCACGTCCGCGGCCTC
ACCGAAGCCTTCCGCCAAGTCGGTCTCGACGCCCGCTTCGTAACAGGCGAGACACCCAAGCTAGAACGCAGCGAG
ACGCTCGAATCCTTCAAGAGCGGCGGCTTCCCCGTCCTCGTCAACTGCGGCGTCTTCACCGAGGGAACCGACATC
CCAAACGTCGACTGCATCGTCCTCGCCCGTCCGACACGCTCGCGCAACCTCCTAGTCCAGATGATCGGTCGAGGC
ATGCGTCTATCCCCGGGCAAAGAAAACTGTCACGTCATCGATTTAGTCTCCAGCCTTGAAACCGGCATCGTCACC
ACCCCAACCCTCTTCGGCCTCGATCCCAGCGAACTAGTGGAAAAGGCGTCCGTCGACGACCTCCGCCACATCAAA
GATCTCGTCGAACAAGCCAAAGAGCGCGACGCAGCCCGCATCCGAGAAGCGGCCCTCTTGGAAGCCGACAACGAC
GACGTCGACGACGACGCCAGCCCAGATTCCCACAACGACGTCGAGGACTCCCGCTCCCCTCCCGCATCCGTCACC
TTTACGGACTACAACTCCGTCCTCGACCTCGTGGCCGACACCTCAAAGAGCAAATGGATCCGCTCCATCAGCCCA
AACGCCTGGGTCCGCACAGCCGAGAACCGCTACATCCTCGCCTCCCCAAAAGGCGACACCCTCCGCATCGAACTC
TCGGAAGCCACCCCAATCGAAGACCCCGATCCCGACGCCGACTCCGACGCCGACCCCGAAACCGACCCCGATGCC
GACTACGACGACCTCGAACAACCCCCCCCCCCCCCAACCCCCCCCAATACCGCGCCCTCTACTACCGCTCCCTCC
GCAACTTCACAACCCCCGCCGGCCAAAAGTACAAGGCCCCCTTCACCAAACCCCGCGAGATCCTCCGCGCCGAAT
CCTTCGAAGCCGCCGTCCACGGCGCCGACAACTGGGCCGCCCACAACTTCCCCCGGACCTTCATCTCCCACTCCC
AACCCTGGCGCCGCCTCCCCGCAACAGAAGGCCAGCTCTCCTTCCTCAACCGCTTCCGCGGCGACGCCGACCAGC
TCCTCCCCGAGGACCTCTCCAAGGGCAAGGCCGCCGACATGATCACGAGGATCAAGTACGGCGCCCGCGGGCAGT
TTTCCAAAATGAAGGGCGAGATCAGGCGGAGGGAGAAGAAGGCTGGCGTTGAGGCTCAGAGGAAGGCGAGGGAGA
TGGTTCAGGTTGGGCCTCTTCAGCGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail