Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04155
Gene name
Locationscaffold_04:1002481..1005760
Strand+
Gene length (bp)3279
Transcript length (bp)2934
Coding sequence length (bp)2934
Protein length (aa) 978

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00013 KH_1 KH domain 4.8E-06 273 338
PF00013 KH_1 KH domain 1.7E-06 558 602

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6908 0.3486 0.1319 0.2365 0.0828 0.0099 0.1055 0.131 0.0776 0.0358

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2379
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4431
Ophiocordyceps australis map64 (Brazil) OphauB2|1164
Ophiocordyceps camponoti-floridani Ophcf2|04155 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4046
Ophiocordyceps kimflemingae Ophio5|3012
Ophiocordyceps subramaniannii Hirsu2|3335

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04155
MNKLANMRHWSERMSPNFGMGRPNMPMNPLTAHPKTVSQPGGPVASPQTADATIHYAFNVPFSSDLAGPNTEDIV
HATTDAVLRWTHPEDAPDDVQVYQLPVHAQNLSNLRKLCNDLTAGPLPIEAHALSSPLKNGKGPHITTVCLSGSP
EAVHKSRESILNEVPISMRCTIIDIDGSLVCDLGAGVLKKPVVETLDYISSFCGVDIFLLGPKLTPMVDGMMGDS
EMRMDQRWRVAIYGDILSSEHAKARVLIHIDTLLGRVVDVAKVELSLQQLVCGRHRKNIKLIESSTGTAIYFPPL
FSQMYRYCPLNANRRDPCDIFITGDTPHAIELAKQKLHETVARIRLYVKDVNIPAAKIDSILLTRLDKVRKILEA
NGTYIIFPPLACQRTLMRVQGSEGLPVERTVRELMSLAGQFYGAAWYTQQTDQRQLLGTADVRAILGDICANSDA
DLSFEKTNFTVTGSDDAVKSALMVISDLRFVTQSPYQIRVKIELANEHKEFVSGKKNGKINKIMGQSNVQIIFDG
FNEYNFNIDVMAASYDSMKQGLTLVEQEMPASISFHVPDQYHKRIIGIGGQHIQRIMKKHSVFVKFSNAMDRGGM
SREDDDIKVDNVICRTPARNAQNLDAVKNEILEMVDRADSEYTTQVASVDRLYHRQLIARLPEIDELEQKYSCKI
NFPSTEEASDEVTVTGPQWQVPHCVDEFLGMVPDRHELVLARSAELVKFLESPQFASDLVGKLRAQYEVEVTVHQ
IPEEVTQDGSPTVTLFWGFTRNNAGGLRDAIDLLQAQVAAAGVETVIVKGSIPRPKSDSFEDSLQYFDSKLLQHA
PTSTAADSPIKVAFGAEVARERSSILDRLRKPGSMTSISSFLDRRKNSSHSINGNFFKGSSNVSKSSLISIESTR
SFNADRNPWNDSGVNLPDDDHPWAPRPLSKQMDGKLSIPLPGDATPRHGTRGSGDSGRPSTSHSMNSGYPGPVGP
FR*
Coding >Ophcf2|04155
ATGAATAAGTTGGCCAACATGCGTCACTGGTCCGAGAGGATGAGCCCCAACTTTGGAATGGGACGACCCAATATG
CCCATGAATCCATTGACGGCCCATCCTAAAACTGTGTCACAACCGGGTGGTCCTGTCGCCTCGCCTCAGACGGCC
GACGCCACGATCCATTATGCCTTCAACGTCCCCTTCTCCTCCGACCTCGCTGGCCCCAATACCGAGGATATTGTC
CACGCCACGACCGACGCCGTTCTTCGATGGACACACCCCGAGGACGCTCCCGACGATGTCCAGGTCTACCAGCTA
CCCGTTCATGCGCAGAACCTGTCCAACCTCCGCAAGCTCTGCAACGACTTGACCGCCGGACCCCTCCCCATCGAA
GCTCATGCTCTGTCGTCGCCCCTCAAGAACGGCAAGGGACCGCACATCACCACCGTCTGCCTGTCTGGCTCTCCC
GAGGCCGTCCACAAGAGCCGCGAAAGCATCCTGAACGAGGTTCCCATCTCAATGCGGTGTACAATTATCGACATC
GACGGCAGCCTCGTTTGCGATCTAGGTGCCGGCGTGCTAAAGAAACCAGTCGTCGAGACGCTTGACTACATCTCG
AGCTTCTGCGGGGTCGACATCTTCCTGCTCGGCCCGAAGCTGACGCCCATGGTGGATGGCATGATGGGCGATTCT
GAGATGCGCATGGATCAGAGGTGGCGGGTTGCCATCTACGGCGATATACTCTCGTCGGAGCACGCCAAAGCCCGC
GTCCTCATCCACATTGATACCCTGCTCGGACGAGTCGTAGACGTCGCCAAGGTGGAATTGTCACTCCAGCAGCTC
GTCTGTGGGCGGCACAGAAAGAATATCAAACTCATCGAATCCTCGACCGGCACCGCAATCTATTTCCCGCCGCTC
TTCTCCCAGATGTACCGATACTGCCCACTCAACGCGAACCGACGTGACCCCTGCGACATCTTTATCACGGGAGAC
ACTCCCCACGCCATCGAGCTGGCGAAGCAGAAGCTGCACGAGACGGTGGCACGCATCCGGCTCTATGTCAAGGAT
GTCAATATCCCTGCCGCCAAGATCGACAGCATCCTGCTCACGAGGCTCGACAAGGTCCGCAAGATCCTCGAGGCC
AACGGGACTTACATCATCTTCCCTCCGCTGGCCTGCCAACGCACCCTGATGCGCGTGCAGGGCAGCGAGGGGCTC
CCGGTGGAGCGAACTGTGCGGGAGCTCATGTCGCTGGCAGGCCAGTTCTACGGGGCTGCATGGTATACGCAGCAG
ACTGATCAGCGTCAGCTCCTCGGTACGGCCGACGTCCGGGCCATCCTTGGCGACATCTGCGCCAATTCGGACGCC
GATCTGTCGTTTGAAAAGACCAACTTTACCGTGACGGGCTCCGATGACGCCGTCAAGTCGGCGCTCATGGTCATC
TCGGACCTTCGATTCGTGACCCAGTCGCCCTACCAGATCCGTGTCAAGATCGAGCTCGCCAACGAACACAAGGAA
TTCGTTAGCGGCAAGAAGAATGGCAAGATCAACAAGATCATGGGCCAGAGCAACGTGCAAATCATCTTTGACGGC
TTCAACGAGTACAATTTCAACATTGACGTCATGGCTGCCAGCTACGACTCCATGAAGCAGGGCCTCACTCTGGTG
GAGCAGGAGATGCCGGCGTCCATCTCGTTCCACGTGCCCGACCAGTATCACAAGCGAATCATTGGCATTGGCGGA
CAGCACATTCAACGCATCATGAAGAAGCACTCCGTCTTCGTCAAGTTTTCCAATGCCATGGACAGAGGGGGCATG
AGCCGTGAAGACGACGATATCAAGGTCGACAACGTCATCTGCCGCACGCCCGCTCGCAACGCGCAGAACTTGGAT
GCCGTCAAGAACGAGATTCTGGAGATGGTTGACCGGGCGGACTCGGAGTACACGACTCAAGTGGCCAGCGTCGAC
CGTCTGTACCACCGGCAGCTCATTGCCCGGCTTCCCGAGATCGATGAGCTTGAGCAGAAATACAGCTGCAAGATA
AACTTCCCTAGCACCGAAGAAGCCAGCGACGAGGTGACGGTGACGGGCCCGCAGTGGCAGGTGCCTCACTGCGTG
GACGAATTTCTCGGCATGGTGCCCGACCGGCACGAGCTGGTCTTGGCCCGGAGCGCGGAGCTGGTCAAGTTCCTC
GAGTCTCCCCAGTTCGCGTCGGACCTGGTCGGCAAGCTCAGGGCTCAGTACGAGGTGGAGGTGACGGTGCATCAG
ATCCCCGAAGAGGTGACGCAGGACGGGTCTCCGACTGTCACGCTGTTCTGGGGCTTCACGCGCAATAACGCGGGC
GGGCTCCGAGATGCCATCGACCTGCTGCAGGCTCAGGTGGCGGCCGCGGGCGTCGAGACGGTCATTGTCAAGGGC
TCCATCCCGCGACCCAAGTCGGACTCGTTCGAGGACTCGCTGCAGTACTTCGACTCCAAGCTGCTGCAGCACGCG
CCCACGTCGACGGCGGCCGACTCGCCCATCAAGGTGGCCTTTGGCGCCGAGGTGGCGCGGGAACGGAGCAGCATC
TTGGACCGGCTCCGCAAGCCGGGCAGCATGACGTCCATCTCGTCCTTCCTCGACCGGCGCAAGAACAGCTCGCAC
TCGATCAATGGCAACTTCTTTAAAGGCTCGAGCAACGTGTCCAAGTCGTCGCTCATCTCGATCGAGTCGACGCGC
AGCTTCAACGCAGACCGCAACCCCTGGAACGACAGCGGCGTCAACCTGCCAGACGACGATCACCCCTGGGCGCCG
CGGCCTCTCAGCAAGCAGATGGACGGCAAGCTGAGCATCCCGCTCCCTGGTGACGCGACGCCGCGTCACGGCACC
CGCGGATCCGGCGATAGCGGGCGGCCGTCGACGTCCCATTCTATGAATTCTGGATACCCCGGCCCGGTTGGGCCT
TTCCGTTAG
Transcript >Ophcf2|04155
ATGAATAAGTTGGCCAACATGCGTCACTGGTCCGAGAGGATGAGCCCCAACTTTGGAATGGGACGACCCAATATG
CCCATGAATCCATTGACGGCCCATCCTAAAACTGTGTCACAACCGGGTGGTCCTGTCGCCTCGCCTCAGACGGCC
GACGCCACGATCCATTATGCCTTCAACGTCCCCTTCTCCTCCGACCTCGCTGGCCCCAATACCGAGGATATTGTC
CACGCCACGACCGACGCCGTTCTTCGATGGACACACCCCGAGGACGCTCCCGACGATGTCCAGGTCTACCAGCTA
CCCGTTCATGCGCAGAACCTGTCCAACCTCCGCAAGCTCTGCAACGACTTGACCGCCGGACCCCTCCCCATCGAA
GCTCATGCTCTGTCGTCGCCCCTCAAGAACGGCAAGGGACCGCACATCACCACCGTCTGCCTGTCTGGCTCTCCC
GAGGCCGTCCACAAGAGCCGCGAAAGCATCCTGAACGAGGTTCCCATCTCAATGCGGTGTACAATTATCGACATC
GACGGCAGCCTCGTTTGCGATCTAGGTGCCGGCGTGCTAAAGAAACCAGTCGTCGAGACGCTTGACTACATCTCG
AGCTTCTGCGGGGTCGACATCTTCCTGCTCGGCCCGAAGCTGACGCCCATGGTGGATGGCATGATGGGCGATTCT
GAGATGCGCATGGATCAGAGGTGGCGGGTTGCCATCTACGGCGATATACTCTCGTCGGAGCACGCCAAAGCCCGC
GTCCTCATCCACATTGATACCCTGCTCGGACGAGTCGTAGACGTCGCCAAGGTGGAATTGTCACTCCAGCAGCTC
GTCTGTGGGCGGCACAGAAAGAATATCAAACTCATCGAATCCTCGACCGGCACCGCAATCTATTTCCCGCCGCTC
TTCTCCCAGATGTACCGATACTGCCCACTCAACGCGAACCGACGTGACCCCTGCGACATCTTTATCACGGGAGAC
ACTCCCCACGCCATCGAGCTGGCGAAGCAGAAGCTGCACGAGACGGTGGCACGCATCCGGCTCTATGTCAAGGAT
GTCAATATCCCTGCCGCCAAGATCGACAGCATCCTGCTCACGAGGCTCGACAAGGTCCGCAAGATCCTCGAGGCC
AACGGGACTTACATCATCTTCCCTCCGCTGGCCTGCCAACGCACCCTGATGCGCGTGCAGGGCAGCGAGGGGCTC
CCGGTGGAGCGAACTGTGCGGGAGCTCATGTCGCTGGCAGGCCAGTTCTACGGGGCTGCATGGTATACGCAGCAG
ACTGATCAGCGTCAGCTCCTCGGTACGGCCGACGTCCGGGCCATCCTTGGCGACATCTGCGCCAATTCGGACGCC
GATCTGTCGTTTGAAAAGACCAACTTTACCGTGACGGGCTCCGATGACGCCGTCAAGTCGGCGCTCATGGTCATC
TCGGACCTTCGATTCGTGACCCAGTCGCCCTACCAGATCCGTGTCAAGATCGAGCTCGCCAACGAACACAAGGAA
TTCGTTAGCGGCAAGAAGAATGGCAAGATCAACAAGATCATGGGCCAGAGCAACGTGCAAATCATCTTTGACGGC
TTCAACGAGTACAATTTCAACATTGACGTCATGGCTGCCAGCTACGACTCCATGAAGCAGGGCCTCACTCTGGTG
GAGCAGGAGATGCCGGCGTCCATCTCGTTCCACGTGCCCGACCAGTATCACAAGCGAATCATTGGCATTGGCGGA
CAGCACATTCAACGCATCATGAAGAAGCACTCCGTCTTCGTCAAGTTTTCCAATGCCATGGACAGAGGGGGCATG
AGCCGTGAAGACGACGATATCAAGGTCGACAACGTCATCTGCCGCACGCCCGCTCGCAACGCGCAGAACTTGGAT
GCCGTCAAGAACGAGATTCTGGAGATGGTTGACCGGGCGGACTCGGAGTACACGACTCAAGTGGCCAGCGTCGAC
CGTCTGTACCACCGGCAGCTCATTGCCCGGCTTCCCGAGATCGATGAGCTTGAGCAGAAATACAGCTGCAAGATA
AACTTCCCTAGCACCGAAGAAGCCAGCGACGAGGTGACGGTGACGGGCCCGCAGTGGCAGGTGCCTCACTGCGTG
GACGAATTTCTCGGCATGGTGCCCGACCGGCACGAGCTGGTCTTGGCCCGGAGCGCGGAGCTGGTCAAGTTCCTC
GAGTCTCCCCAGTTCGCGTCGGACCTGGTCGGCAAGCTCAGGGCTCAGTACGAGGTGGAGGTGACGGTGCATCAG
ATCCCCGAAGAGGTGACGCAGGACGGGTCTCCGACTGTCACGCTGTTCTGGGGCTTCACGCGCAATAACGCGGGC
GGGCTCCGAGATGCCATCGACCTGCTGCAGGCTCAGGTGGCGGCCGCGGGCGTCGAGACGGTCATTGTCAAGGGC
TCCATCCCGCGACCCAAGTCGGACTCGTTCGAGGACTCGCTGCAGTACTTCGACTCCAAGCTGCTGCAGCACGCG
CCCACGTCGACGGCGGCCGACTCGCCCATCAAGGTGGCCTTTGGCGCCGAGGTGGCGCGGGAACGGAGCAGCATC
TTGGACCGGCTCCGCAAGCCGGGCAGCATGACGTCCATCTCGTCCTTCCTCGACCGGCGCAAGAACAGCTCGCAC
TCGATCAATGGCAACTTCTTTAAAGGCTCGAGCAACGTGTCCAAGTCGTCGCTCATCTCGATCGAGTCGACGCGC
AGCTTCAACGCAGACCGCAACCCCTGGAACGACAGCGGCGTCAACCTGCCAGACGACGATCACCCCTGGGCGCCG
CGGCCTCTCAGCAAGCAGATGGACGGCAAGCTGAGCATCCCGCTCCCTGGTGACGCGACGCCGCGTCACGGCACC
CGCGGATCCGGCGATAGCGGGCGGCCGTCGACGTCCCATTCTATGAATTCTGGATACCCCGGCCCGGTTGGGCCT
TTCCGTTAG
Gene >Ophcf2|04155
ATGAATAAGTTGGCCAACATGCGTCACTGGTCCGAGAGGATGAGCCCCAACTTTGGAATGGGACGACCCAATATG
CCCATGAATCCATTGACGGCCCATCCTAAAACTGTGTCACAACCGGGTGGTCCTGTCGCCTCGCCTCAGACGGCC
GACGCCACGATCCATTATGCCTTCAACGTCCCCTTCTCCTCCGACCTCGCTGGCCCCAATACCGAGGATATTGTC
CACGCCACGACCGACGCCGTTCTTCGATGGACACACCCCGAGGACGCTCCCGACGATGTCCAGGTCTACCAGCTA
CCCGTTCATGCGCAGAACCTGTCCAACCTCCGCAAGCTCTGCAACGACTTGACCGCCGGACCCCTCCCCATCGAA
GCTCATGCTCTGTCGTCGCCCCTCAAGAACGGCAAGGGACCGCACATCACCACCGTCTGCCTGTCTGGCTCTCCC
GAGGCCGTCCACAAGAGCCGCGAAAGCATCCTGAACGAGGTTCCCATCTCAATGGTAGGGCGTCTCCCTTCAGAC
ACTGTCTTATCGCGGAAATGCTCACGGTCGATGACCCATAGCGGTGTACAATTATCGACATCGACGGCAGCCTCG
TTTGCGATCTAGGTGCCGGCGTGCTAAAGAAACCAGTCGTCGAGACGCTTGACTACATCTCGAGCTTCTGCGGGG
TCGACATCTTCCTGCTCGGCCCGAAGCTGACGCCCATGGTGGATGGCATGATGGGCGATTCTGAGATGCGCATGG
ATCAGAGGTGGCGGGTTGCCATCTACGGCGATATACTCTCGTCGGAGCACGCCAAAGCCCGCGTCCTCATCCACA
TTGATACCCTGGTATGCCTCGCCTGGCCTCTCTTCCCCACGACTCGGACGCCTCCTAACTCGGCTGCAGCTCGGA
CGAGTCGTAGACGTCGCCAAGGTGGAATTGTCACTCCAGCAGCTCGTCTGTGGGCGGCACAGAAAGAATATCAAA
CTCATCGAATCCTCGACCGGCACCGCAATCTATTTCCCGCCGCTCTTCTCCCAGATGTACCGATACTGCCCACTC
AACGCGAACCGACGTGACCCCTGCGACATCTTTATCACGGGAGACACTCCCCACGCCATCGAGCTGGCGAAGCAG
AAGCTGCACGAGACGGTGGCACGCATCCGGCTCTATGTCAAGGATGTCAATATCCCTGCCGCCAAGATCGACAGC
ATCCTGCTCACGAGGCTCGACAAGGTCCGCAAGATCCTCGAGGCCAACGGGACTTACATCATCTTCCCTCCGCTG
GCCTGCCAACGCACCCTGATGCGCGTGCAGGGCAGCGAGGGGCTCCCGGTGGAGCGAACTGTGCGGGAGCTCATG
TCGCTGGTGGGTGTCGGCTGTCGACCCGTGTGCCAGTCCGTGCGCTGACGCCCTCTCGCAGGCAGGCCAGTTCTA
CGGGGCTGCATGGTATACGCAGCAGACTGATCAGCGTCAGCTCCTCGGTACGGCCGACGTCCGGGCCATCCTTGG
CGACATCTGCGCCAATTCGGACGCCGATCTGTCGTTTGAAAAGACCAACTTTACCGTGACGGGCTCCGATGACGC
CGTCAAGTCGGCGCTCATGGTCATCTCGGACCTTCGATTCGTGACCCAGTCGCCCTACCAGATCCGTGTCAAGAT
CGAGCTCGCCAACGAACACAAGGAATTCGTTAGCGGCAAGAAGAATGGCAAGATCAACAAGATCATGGGCCAGAG
TACGTTGGTCCTCGGCGACGTTCAACTCGGGAATTGACGGCGTCTTCTGTAGGCAACGTGCAAATCATCTTTGAC
GGCTTCAACGAGTACAATTTCAACATTGACGTCATGGCTGCCAGCTACGACTCCATGAAGCAGGGCCTCACTCTG
GTGGAGCAGGAGATGCCGGCGTCCATCTCGTTCCACGTGCCCGACCAGTATCACAAGCGAATCATTGGCATTGGC
GGACAGCACATTCAACGCATCATGAAGAAGCACTCCGTCTTCGTCAAGTTTTCCAATGCCATGGACAGAGGTGAG
CGGCGAGTGTCCAAGGTATCGGAGTGCGTACTCATTGACCGTCTGCAAGGGGGCATGAGCCGTGAAGACGACGAT
ATCAAGGTCGACAACGTCATCTGCCGCACGCCCGCTCGCAACGCGCAGAACTTGGATGCCGTCAAGAACGAGATT
CTGGAGATGGTTGACCGGGCGGTAAGTTGCCTCGGCTGCTCCAACCACGTCTTCGCCTGTGCTGACGAGGCTGTG
TGCCTCTAGGACTCGGAGTACACGACTCAAGTGGCCAGCGTCGACCGTCTGTACCACCGGCAGCTCATTGCCCGG
CTTCCCGAGATCGATGAGCTTGAGCAGAAATACAGCTGCAAGATAAACTTCCCTAGCACCGAAGAAGCCAGCGAC
GAGGTGACGGTGACGGGCCCGCAGTGGCAGGTGCCTCACTGCGTGGACGAATTTCTCGGCATGGTGCCCGACCGG
CACGAGCTGGTCTTGGCCCGGAGCGCGGAGCTGGTCAAGTTCCTCGAGTCTCCCCAGTTCGCGTCGGACCTGGTC
GGCAAGCTCAGGGCTCAGTACGAGGTGGAGGTGACGGTGCATCAGATCCCCGAAGAGGTGACGCAGGACGGGTCT
CCGACTGTCACGCTGTTCTGGGGCTTCACGCGCAATAACGCGGGCGGGCTCCGAGATGCCATCGACCTGCTGCAG
GCTCAGGTGGCGGCCGCGGGCGTCGAGACGGTCATTGTCAAGGGCTCCATCCCGCGACCCAAGTCGGACTCGTTC
GAGGACTCGCTGCAGTACTTCGACTCCAAGCTGCTGCAGCACGCGCCCACGTCGACGGCGGCCGACTCGCCCATC
AAGGTGGCCTTTGGCGCCGAGGTGGCGCGGGAACGGAGCAGCATCTTGGACCGGCTCCGCAAGCCGGGCAGCATG
ACGTCCATCTCGTCCTTCCTCGACCGGCGCAAGAACAGCTCGCACTCGATCAATGGCAACTTCTTTAAAGGCTCG
AGCAACGTGTCCAAGTCGTCGCTCATCTCGATCGAGTCGACGCGCAGCTTCAACGCAGACCGCAACCCCTGGAAC
GACAGCGGCGTCAACCTGCCAGACGACGATCACCCCTGGGCGCCGCGGCCTCTCAGCAAGCAGATGGACGGCAAG
CTGAGCATCCCGCTCCCTGGTGACGCGACGCCGCGTCACGGCACCCGCGGATCCGGCGATAGCGGGCGGCCGTCG
ACGTCCCATTCTATGAATTCTGGATACCCCGGCCCGGTTGGGCCTTTCCGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail