Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04152
Gene name
Locationscaffold_04:995739..996276
Strand+
Gene length (bp)537
Transcript length (bp)417
Coding sequence length (bp)417
Protein length (aa) 139

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11221 Med21 Subunit 21 of Mediator complex 2.1E-46 1 136

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.7806 0.4551 0.0199 0.1458 0.1656 0.0025 0.1159 0.2009 0.1595 0.0469

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4312
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|992
Ophiocordyceps australis map64 (Brazil) OphauB2|3373
Ophiocordyceps camponoti-floridani Ophcf2|04152 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4050
Ophiocordyceps kimflemingae Ophio5|3009
Ophiocordyceps subramaniannii Hirsu2|8851

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04152
MGDRLTQLQDAVDQLAQQFVASLHFVHRRHDLETLGPNDKIRDIKQEPHQKEVDPLPADEFQAGLKELSRDLIVK
EQEIEYLISMLPGLENSENDQEKNIRDLEEDLKTAEALRQEALREKDEILAELDAVIRSIRRP*
Coding >Ophcf2|04152
ATGGGAGACCGACTCACGCAGCTTCAAGATGCTGTTGATCAGCTGGCGCAACAATTTGTCGCCTCTTTGCACTTC
GTCCACCGCAGACACGATCTGGAGACGCTCGGCCCGAACGATAAGATCCGTGACATCAAGCAGGAGCCTCATCAG
AAAGAAGTCGATCCGCTGCCCGCCGACGAGTTTCAAGCCGGCCTAAAGGAGCTCTCGAGAGACCTTATCGTCAAA
GAGCAGGAAATCGAATACCTCATCTCCATGCTACCAGGACTCGAAAATAGCGAGAATGATCAGGAGAAGAATATC
CGGGATCTTGAAGAGGACCTCAAAACCGCCGAGGCCCTAAGGCAGGAGGCGCTCAGGGAAAAGGACGAGATTCTT
GCTGAGCTCGACGCGGTCATTCGCAGCATTCGTCGGCCATGA
Transcript >Ophcf2|04152
ATGGGAGACCGACTCACGCAGCTTCAAGATGCTGTTGATCAGCTGGCGCAACAATTTGTCGCCTCTTTGCACTTC
GTCCACCGCAGACACGATCTGGAGACGCTCGGCCCGAACGATAAGATCCGTGACATCAAGCAGGAGCCTCATCAG
AAAGAAGTCGATCCGCTGCCCGCCGACGAGTTTCAAGCCGGCCTAAAGGAGCTCTCGAGAGACCTTATCGTCAAA
GAGCAGGAAATCGAATACCTCATCTCCATGCTACCAGGACTCGAAAATAGCGAGAATGATCAGGAGAAGAATATC
CGGGATCTTGAAGAGGACCTCAAAACCGCCGAGGCCCTAAGGCAGGAGGCGCTCAGGGAAAAGGACGAGATTCTT
GCTGAGCTCGACGCGGTCATTCGCAGCATTCGTCGGCCATGA
Gene >Ophcf2|04152
ATGGGAGACCGACTCACGCAGCTTCAAGATGCTGTTGATCAGGCAAGTCACATATTGCTTGCCTGTATTCATATG
ATTTTGACGCCGCTGACTGTCCTGCAGCTGGCGCAACAATTTGTCGCCTCTTTGCACTTCGTCCACCGCAGACAC
GATCTGGAGACGCTCGGCCCGAACGATAAGATCCGTGACATCAAGCAGGAGCCTCATCAGAAAGAAGGTACTTTA
TGCTTTTAGGATGACGCTCTGTGTCTTTATGTTGACGTGCGGTCGCCCTCAGTCGATCCGCTGCCCGCCGACGAG
TTTCAAGCCGGCCTAAAGGAGCTCTCGAGAGACCTTATCGTCAAAGAGCAGGAAATCGAATACCTCATCTCCATG
CTACCAGGACTCGAAAATAGCGAGAATGATCAGGAGAAGAATATCCGGGATCTTGAAGAGGACCTCAAAACCGCC
GAGGCCCTAAGGCAGGAGGCGCTCAGGGAAAAGGACGAGATTCTTGCTGAGCTCGACGCGGTCATTCGCAGCATT
CGTCGGCCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail