Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04151
Gene name
Locationscaffold_04:994157..995438
Strand-
Gene length (bp)1281
Transcript length (bp)1182
Coding sequence length (bp)1182
Protein length (aa) 394

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03839 Sec62 Translocation protein Sec62 2.8E-63 135 321

GO

GO Term Description Terminal node
GO:0030176 integral component of endoplasmic reticulum membrane Yes
GO:0015031 protein transport Yes
GO:0031300 intrinsic component of organelle membrane No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0070727 cellular macromolecule localization No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0033036 macromolecule localization No
GO:0071702 organic substance transport No
GO:0008104 protein localization No
GO:0016021 integral component of membrane No
GO:0031224 intrinsic component of membrane No
GO:0051641 cellular localization No
GO:0031227 intrinsic component of endoplasmic reticulum membrane No
GO:0005575 cellular_component No
GO:0031301 integral component of organelle membrane No
GO:0071705 nitrogen compound transport No
GO:0045184 establishment of protein localization No
GO:0008150 biological_process No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 236 258 22
2 265 287 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04151
MSAQGPPFPPGQGPTPEQIAEMQRRVAEDAQKAGMSVPEFIAHIKKQTLQQQRMRFHQQQQQHSHDGHHCCDHDH
DHDDEDDDDDDHHHHHHHHQGHSQPITPGPPNPKAIAVAKFLKGQELKPRTCILNGERKDMFKVKRALRALQSPA
YEKARKKNPLLPEITDQASLENTFKLLPLSMLALRVSKIETELGPNGKKPKRVKGQWNVRVEQQQEANEEMYYVW
LWEGSQIKRQIYAALALVVIFIVVLYPLWPLKLRQGVYYLSWGLLGLLGLFFLMAIFRVILFCVTYFAVPPGLWL
YPNLWEDVSFMDSFRPVWAWHETAEEKKLKKKSKKKARAAGSGGGTNATFAAATGQVAPTTATTTGTDTQIKTGD
MHQRNYVAPKVEELADDE*
Coding >Ophcf2|04151
ATGTCTGCGCAAGGACCACCGTTCCCGCCTGGCCAGGGCCCGACGCCCGAGCAGATCGCCGAAATGCAGCGAAGG
GTCGCCGAAGATGCGCAAAAGGCGGGCATGTCGGTGCCCGAGTTCATCGCACACATAAAGAAGCAGACGTTGCAG
CAACAGCGCATGCGCTTCCACCAGCAGCAACAGCAGCATTCTCACGACGGACACCACTGCTGCGACCACGACCAC
GACCACGATGATGAGGACGACGATGACGATGACCACCATCATCACCATCACCACCACCAGGGTCACTCTCAGCCC
ATTACGCCGGGTCCTCCGAACCCCAAGGCTATCGCCGTTGCTAAGTTCCTCAAGGGTCAAGAGTTGAAGCCACGT
ACCTGCATTCTGAATGGGGAGCGAAAGGACATGTTTAAAGTGAAACGTGCCCTTCGGGCCTTGCAGTCGCCTGCC
TACGAAAAGGCTCGCAAGAAGAACCCCTTGCTACCGGAGATCACCGACCAGGCCTCGCTCGAGAACACGTTTAAA
TTACTACCTCTGAGCATGCTCGCCCTGCGTGTTTCCAAGATCGAGACGGAGCTGGGACCCAACGGAAAGAAGCCT
AAGCGCGTAAAGGGCCAATGGAATGTTCGCGTCGAGCAGCAACAAGAGGCTAATGAAGAGATGTATTACGTCTGG
CTGTGGGAGGGCAGCCAGATCAAACGTCAGATTTATGCGGCCCTCGCCCTCGTCGTCATCTTCATCGTCGTCCTG
TATCCGCTCTGGCCGTTGAAGCTGCGCCAAGGCGTCTACTATCTCAGCTGGGGTCTTCTGGGTCTTCTGGGTCTG
TTCTTCCTCATGGCCATCTTCCGCGTTATCCTCTTCTGCGTCACTTATTTCGCCGTCCCTCCCGGTCTTTGGCTC
TACCCCAACCTGTGGGAGGATGTCTCTTTCATGGACAGTTTCAGACCCGTCTGGGCCTGGCACGAGACTGCTGAG
GAAAAGAAGTTGAAGAAGAAGTCGAAGAAGAAGGCCAGAGCAGCTGGCTCTGGAGGTGGCACCAACGCCACGTTC
GCCGCCGCCACCGGCCAGGTCGCGCCGACGACCGCTACGACAACGGGCACCGACACTCAAATCAAGACTGGTGAC
ATGCATCAGCGGAATTACGTCGCGCCCAAGGTCGAGGAGCTGGCGGATGACGAGTGA
Transcript >Ophcf2|04151
ATGTCTGCGCAAGGACCACCGTTCCCGCCTGGCCAGGGCCCGACGCCCGAGCAGATCGCCGAAATGCAGCGAAGG
GTCGCCGAAGATGCGCAAAAGGCGGGCATGTCGGTGCCCGAGTTCATCGCACACATAAAGAAGCAGACGTTGCAG
CAACAGCGCATGCGCTTCCACCAGCAGCAACAGCAGCATTCTCACGACGGACACCACTGCTGCGACCACGACCAC
GACCACGATGATGAGGACGACGATGACGATGACCACCATCATCACCATCACCACCACCAGGGTCACTCTCAGCCC
ATTACGCCGGGTCCTCCGAACCCCAAGGCTATCGCCGTTGCTAAGTTCCTCAAGGGTCAAGAGTTGAAGCCACGT
ACCTGCATTCTGAATGGGGAGCGAAAGGACATGTTTAAAGTGAAACGTGCCCTTCGGGCCTTGCAGTCGCCTGCC
TACGAAAAGGCTCGCAAGAAGAACCCCTTGCTACCGGAGATCACCGACCAGGCCTCGCTCGAGAACACGTTTAAA
TTACTACCTCTGAGCATGCTCGCCCTGCGTGTTTCCAAGATCGAGACGGAGCTGGGACCCAACGGAAAGAAGCCT
AAGCGCGTAAAGGGCCAATGGAATGTTCGCGTCGAGCAGCAACAAGAGGCTAATGAAGAGATGTATTACGTCTGG
CTGTGGGAGGGCAGCCAGATCAAACGTCAGATTTATGCGGCCCTCGCCCTCGTCGTCATCTTCATCGTCGTCCTG
TATCCGCTCTGGCCGTTGAAGCTGCGCCAAGGCGTCTACTATCTCAGCTGGGGTCTTCTGGGTCTTCTGGGTCTG
TTCTTCCTCATGGCCATCTTCCGCGTTATCCTCTTCTGCGTCACTTATTTCGCCGTCCCTCCCGGTCTTTGGCTC
TACCCCAACCTGTGGGAGGATGTCTCTTTCATGGACAGTTTCAGACCCGTCTGGGCCTGGCACGAGACTGCTGAG
GAAAAGAAGTTGAAGAAGAAGTCGAAGAAGAAGGCCAGAGCAGCTGGCTCTGGAGGTGGCACCAACGCCACGTTC
GCCGCCGCCACCGGCCAGGTCGCGCCGACGACCGCTACGACAACGGGCACCGACACTCAAATCAAGACTGGTGAC
ATGCATCAGCGGAATTACGTCGCGCCCAAGGTCGAGGAGCTGGCGGATGACGAGTGA
Gene >Ophcf2|04151
ATGTCTGCGCAAGGACCACCGTTCCCGCCTGGCCAGGGCCCGACGCCCGAGCAGATCGCCGAAATGCAGCGAAGG
GTCGCCGAAGATGCGCAAAAGGCGGGCATGTCGGTGCCCGAGTTCATCGCACACATAAAGAAGCAGACGTTGCAG
CAACAGCGCATGCGCTTCCACCAGCAGCAACAGCAGCATTCTCACGACGGACACCACTGCTGCGACCACGACCAC
GACCACGATGATGAGGACGACGATGACGATGACCACCATCATCACCATCACCACCACCAGGGTCACTCTCAGCCC
ATTACGCCGGGTCCTCCGAACCCCAAGGCTATCGCCGTTGCTAAGTTCCTCAAGGGTCAAGAGTTGAAGCCACGT
ACCTGCATTCTGAATGGGGAGCGAAAGGACATGTTTAAAGGCATGAACTCGGATACCCTTCCACCGAAGTCTCGC
TAACAGTTCGAACAGTGAAACGTGCCCTTCGGGCCTTGCAGTCGCCTGCCTACGAAAAGGCTCGCAAGAAGAACC
CCTTGCTACCGGAGATCACCGACCAGGCCTCGCTCGAGAACACGTTTAAATTACTACCTCTGAGCATGCTCGCCC
TGCGTGTTTCCAAGATCGAGACGGAGCTGGGACCCAACGGAAAGAAGCCTAAGCGCGTAAAGGGCCAATGGAATG
TTCGCGTCGAGCAGCAACAAGAGGCTAATGAAGAGATGTATTACGTCTGGCTGTGGGAGGGCAGCCAGATCAAAC
GTCAGATTTATGCGGCCCTCGCCCTCGTCGTCATCTTCATCGTCGTCCTGTATCCGCTCTGGCCGTTGAAGCTGC
GCCAAGGCGTCTACTATCTCAGCTGGGGTCTTCTGGGTCTTCTGGGTCTGTTCTTCCTCATGGCCATCTTCCGCG
TTATCCTCTTCTGCGTCACTTATTTCGCCGTCCCTCCCGGTCTTTGGCTCTACCCCAACCTGTGGGAGGATGTCT
CTTTCATGGACAGTTTCAGACCCGTCTGGGCCTGGCACGAGGTAAGCTCGAGCGCTCGACCAGTTTCGACCAGAC
TAACAATGCCGCCAGACTGCTGAGGAAAAGAAGTTGAAGAAGAAGTCGAAGAAGAAGGCCAGAGCAGCTGGCTCT
GGAGGTGGCACCAACGCCACGTTCGCCGCCGCCACCGGCCAGGTCGCGCCGACGACCGCTACGACAACGGGCACC
GACACTCAAATCAAGACTGGTGACATGCATCAGCGGAATTACGTCGCGCCCAAGGTCGAGGAGCTGGCGGATGAC
GAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail