Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04146
Gene name
Locationscaffold_04:977939..981247
Strand+
Gene length (bp)3308
Transcript length (bp)3123
Coding sequence length (bp)3123
Protein length (aa) 1041

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 2.4E-46 233 433

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.661 0.2831 0.0815 0.1816 0.153 0.0097 0.2244 0.4338 0.6111 0.0243

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3924
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4423
Ophiocordyceps australis map64 (Brazil) OphauB2|1172
Ophiocordyceps camponoti-floridani Ophcf2|04146 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4055
Ophiocordyceps kimflemingae Ophio5|3002
Ophiocordyceps subramaniannii Hirsu2|7813

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04146
MATAPADDHDICPHNSSGPAAAAADEPASVRANMAHDSMVTVRLSGSASSVDAAAPESTQPETDCDHVDVTENLR
HSRPDSSVTLSPTTSAHDDMALPGNDSDSFEDAEEVNWAELEKTEDEQVKDDETDNSTALLLARLEQENAKLATN
PKSVKVQAVDKAISANPRSPSMAQLRQMMKGPTPPALRYSMLPPPPMTDLEFYAALVKDYQQTAARLPTLLSNKI
RKGIPPPLRGVVWQSMSGARDALLEEQYDTFSNEASPYELLIGKDLGRSFPGVDMFRDSDGDGQRMLGRVLKSFS
LYDAKIGYCQGLAFLVGPLLMHMPDKQAFCVLVRLMERYDLRACFLPDLSGLHVRIFQFRELLRLNFPVLSTHLE
DLQVETAYVSQWFLSFFAVTCPLPMLFRIYDVIFAEGASETLMRVALSLMRKNEARLLACTELEDVMQLLLSRGL
WDCYHYDADDFVQDFVSLTGVVTREKLAQLEQGYRESQVATLSATRASDITTAATRFLGRIWASSTGNKTSTLQP
GQGAPPRPLSMLRRSTSKQSLASTLYSMEASSVSIASSASSSTDATTLSRHSANTDDGGSTRESTPVGLKSMGTA
AKPTDDRYLHSQIEDLLTALSELQRNNSLVTNQLQWEREERAEDRKAVRLLLGELRKRAATMLPDTMTAECDADE
RESSPVEDEVDEEAASVEDDADETASPAEGQALEEAAASAEGEADGDTASVEGEAGEEATASVKGEADDVTAPVE
SDADEETPLAEDKGPELTVDAQEPAWTKEISDLVERVERRFRSDKEQQHSSILLSKSQLRDELRSAQDQLASAAC
QSQDLSRRIHDMDQETASLKEQLRERHNQVRTLHQEKQRLEKQVQAMRCRGSAGSPTDGASRDSEMDFVTRAIPA
GLRELKLGRSQSITSPVSAFCKRGSSLSRFPDTAPQSRSLGGTPAASEHEALLLELVQAKTAEAMAKQEAEEAKQ
KLEAMRKSSSPAESGTSAAPTPSNTTLGMLSRLTGHGNTEQGGKAAVATTPSASTAGGGFWSRLL*
Coding >Ophcf2|04146
ATGGCAACGGCGCCGGCCGACGACCATGACATATGCCCTCATAACTCCTCGGGGCCTGCAGCCGCCGCCGCTGAC
GAGCCGGCCTCCGTCCGTGCCAACATGGCCCACGACTCCATGGTGACTGTCAGGCTCTCTGGATCCGCCTCTTCC
GTCGACGCCGCCGCCCCCGAGAGCACCCAGCCCGAGACCGACTGCGACCACGTGGACGTCACCGAAAACCTACGA
CACTCACGCCCCGACTCATCGGTCACGCTATCGCCAACCACCTCCGCCCACGACGACATGGCACTGCCCGGAAAC
GACAGCGACTCCTTCGAGGACGCCGAAGAGGTCAACTGGGCCGAGCTCGAAAAGACCGAAGACGAGCAGGTCAAG
GACGACGAGACGGACAATTCGACCGCTCTTCTCCTCGCTCGCCTCGAGCAGGAAAACGCAAAGTTGGCAACCAAT
CCAAAGAGTGTCAAGGTCCAGGCCGTGGACAAGGCCATCTCCGCCAACCCCCGGTCGCCCTCCATGGCTCAGCTT
CGACAGATGATGAAGGGGCCCACGCCGCCCGCCTTGCGGTACTCGATGCTTCCCCCGCCCCCCATGACGGACCTC
GAGTTCTACGCGGCCCTCGTCAAGGACTATCAGCAGACGGCCGCACGCCTCCCGACCCTGTTGTCTAACAAGATC
CGCAAAGGCATCCCTCCGCCGCTGAGGGGCGTCGTATGGCAGAGCATGTCCGGCGCCCGTGACGCCCTCCTCGAG
GAGCAGTACGATACTTTCAGCAACGAAGCTAGCCCCTATGAGCTTCTGATTGGAAAAGACCTCGGTAGAAGTTTT
CCCGGCGTCGACATGTTTCGAGACTCCGACGGCGATGGGCAGCGCATGCTGGGGCGCGTGCTCAAGAGCTTCAGC
CTCTACGATGCCAAGATTGGCTACTGTCAGGGCCTCGCCTTCCTCGTCGGCCCTCTGCTGATGCATATGCCCGAT
AAGCAGGCGTTCTGTGTTCTGGTCCGGTTGATGGAGAGATACGACCTGCGGGCTTGCTTTCTCCCAGATCTCTCC
GGTCTTCACGTTCGCATCTTCCAATTCCGAGAGCTGCTCCGGCTCAACTTTCCTGTGCTATCGACCCATCTGGAA
GACCTGCAGGTGGAGACGGCCTATGTTTCGCAGTGGTTCCTCAGCTTCTTTGCCGTAACATGTCCCCTGCCTATG
CTGTTCCGGATCTACGACGTCATATTCGCCGAAGGTGCTTCCGAGACCCTGATGCGCGTCGCTCTCTCCCTCATG
AGAAAGAACGAGGCGCGCCTCTTGGCCTGCACCGAGCTGGAAGACGTCATGCAGCTTCTCTTATCCCGAGGCCTG
TGGGACTGCTACCACTACGACGCCGACGACTTCGTCCAAGACTTTGTCAGCCTGACGGGCGTCGTCACGAGGGAG
AAGCTAGCCCAGCTAGAGCAGGGATACCGGGAATCGCAGGTAGCGACTTTGAGCGCCACCCGGGCGTCCGACATC
ACCACGGCCGCGACCCGTTTCCTCGGCCGCATCTGGGCGTCGTCGACGGGGAACAAGACGTCGACGCTTCAGCCC
GGTCAAGGGGCCCCTCCGCGGCCGCTCAGCATGCTGCGGCGCAGCACGTCCAAGCAGAGCCTGGCATCGACGCTC
TACTCGATGGAGGCCAGCTCGGTCAGCATCGCGAGCTCGGCCTCGTCATCGACAGACGCGACCACGTTGTCTCGG
CACTCGGCCAACACCGACGACGGGGGCTCGACCCGCGAGTCTACGCCCGTCGGCTTGAAGTCGATGGGGACCGCC
GCCAAGCCCACGGACGACAGGTATCTACACAGCCAGATCGAAGATCTCCTGACGGCCTTGAGCGAGCTGCAGCGC
AACAACAGCCTCGTCACGAACCAACTTCAGTGGGAGCGGGAAGAACGGGCGGAGGATCGCAAGGCGGTCCGGTTG
CTCCTTGGTGAACTCCGGAAGAGGGCTGCCACCATGTTGCCTGACACGATGACGGCAGAATGTGATGCGGACGAG
AGGGAGTCCTCCCCGGTAGAAGACGAGGTCGATGAGGAAGCTGCGTCGGTCGAGGACGATGCCGATGAAACTGCT
TCGCCCGCAGAGGGCCAGGCACTTGAAGAAGCTGCGGCTTCGGCGGAGGGCGAGGCTGATGGAGATACGGCTTCA
GTGGAGGGCGAGGCTGGTGAAGAAGCTACGGCTTCAGTAAAGGGCGAAGCTGATGACGTCACGGCGCCAGTGGAG
AGCGATGCTGATGAAGAAACGCCGCTGGCGGAAGACAAGGGACCCGAGCTCACCGTGGACGCGCAAGAGCCTGCT
TGGACCAAGGAGATTTCCGATCTCGTGGAACGGGTGGAGAGACGGTTCCGAAGCGACAAGGAGCAACAGCATTCG
TCGATACTACTGTCCAAATCGCAGCTCAGGGATGAGCTGCGCAGCGCGCAAGACCAGCTGGCGAGCGCGGCCTGC
CAATCTCAGGACCTGAGCCGGCGGATCCACGACATGGACCAGGAGACGGCATCACTCAAAGAGCAGCTCCGCGAA
AGGCACAACCAAGTGCGGACGCTTCACCAAGAGAAGCAAAGGTTGGAGAAACAGGTGCAGGCAATGCGCTGCCGG
GGCTCGGCCGGCTCACCAACCGACGGTGCCAGTCGGGACTCGGAGATGGACTTTGTCACCAGAGCCATCCCGGCG
GGCTTGAGAGAGCTGAAGCTGGGGCGCAGCCAGTCGATAACGTCGCCAGTATCGGCGTTTTGCAAGAGAGGCTCC
TCTCTGTCTCGGTTTCCGGACACAGCGCCGCAGTCGAGGTCGCTGGGCGGAACGCCGGCTGCCAGCGAGCACGAG
GCGCTGCTGCTGGAACTCGTGCAAGCCAAGACGGCGGAAGCCATGGCGAAGCAGGAGGCAGAGGAGGCCAAGCAG
AAGCTCGAGGCGATGCGCAAGTCTTCGAGCCCGGCAGAGTCCGGGACCAGCGCGGCACCGACGCCATCCAACACT
ACGCTCGGGATGCTCAGCCGCTTGACGGGTCACGGAAACACGGAACAGGGCGGCAAGGCGGCCGTCGCCACGACA
CCGAGCGCTTCGACGGCCGGCGGCGGATTCTGGTCTCGACTGCTGTGA
Transcript >Ophcf2|04146
ATGGCAACGGCGCCGGCCGACGACCATGACATATGCCCTCATAACTCCTCGGGGCCTGCAGCCGCCGCCGCTGAC
GAGCCGGCCTCCGTCCGTGCCAACATGGCCCACGACTCCATGGTGACTGTCAGGCTCTCTGGATCCGCCTCTTCC
GTCGACGCCGCCGCCCCCGAGAGCACCCAGCCCGAGACCGACTGCGACCACGTGGACGTCACCGAAAACCTACGA
CACTCACGCCCCGACTCATCGGTCACGCTATCGCCAACCACCTCCGCCCACGACGACATGGCACTGCCCGGAAAC
GACAGCGACTCCTTCGAGGACGCCGAAGAGGTCAACTGGGCCGAGCTCGAAAAGACCGAAGACGAGCAGGTCAAG
GACGACGAGACGGACAATTCGACCGCTCTTCTCCTCGCTCGCCTCGAGCAGGAAAACGCAAAGTTGGCAACCAAT
CCAAAGAGTGTCAAGGTCCAGGCCGTGGACAAGGCCATCTCCGCCAACCCCCGGTCGCCCTCCATGGCTCAGCTT
CGACAGATGATGAAGGGGCCCACGCCGCCCGCCTTGCGGTACTCGATGCTTCCCCCGCCCCCCATGACGGACCTC
GAGTTCTACGCGGCCCTCGTCAAGGACTATCAGCAGACGGCCGCACGCCTCCCGACCCTGTTGTCTAACAAGATC
CGCAAAGGCATCCCTCCGCCGCTGAGGGGCGTCGTATGGCAGAGCATGTCCGGCGCCCGTGACGCCCTCCTCGAG
GAGCAGTACGATACTTTCAGCAACGAAGCTAGCCCCTATGAGCTTCTGATTGGAAAAGACCTCGGTAGAAGTTTT
CCCGGCGTCGACATGTTTCGAGACTCCGACGGCGATGGGCAGCGCATGCTGGGGCGCGTGCTCAAGAGCTTCAGC
CTCTACGATGCCAAGATTGGCTACTGTCAGGGCCTCGCCTTCCTCGTCGGCCCTCTGCTGATGCATATGCCCGAT
AAGCAGGCGTTCTGTGTTCTGGTCCGGTTGATGGAGAGATACGACCTGCGGGCTTGCTTTCTCCCAGATCTCTCC
GGTCTTCACGTTCGCATCTTCCAATTCCGAGAGCTGCTCCGGCTCAACTTTCCTGTGCTATCGACCCATCTGGAA
GACCTGCAGGTGGAGACGGCCTATGTTTCGCAGTGGTTCCTCAGCTTCTTTGCCGTAACATGTCCCCTGCCTATG
CTGTTCCGGATCTACGACGTCATATTCGCCGAAGGTGCTTCCGAGACCCTGATGCGCGTCGCTCTCTCCCTCATG
AGAAAGAACGAGGCGCGCCTCTTGGCCTGCACCGAGCTGGAAGACGTCATGCAGCTTCTCTTATCCCGAGGCCTG
TGGGACTGCTACCACTACGACGCCGACGACTTCGTCCAAGACTTTGTCAGCCTGACGGGCGTCGTCACGAGGGAG
AAGCTAGCCCAGCTAGAGCAGGGATACCGGGAATCGCAGGTAGCGACTTTGAGCGCCACCCGGGCGTCCGACATC
ACCACGGCCGCGACCCGTTTCCTCGGCCGCATCTGGGCGTCGTCGACGGGGAACAAGACGTCGACGCTTCAGCCC
GGTCAAGGGGCCCCTCCGCGGCCGCTCAGCATGCTGCGGCGCAGCACGTCCAAGCAGAGCCTGGCATCGACGCTC
TACTCGATGGAGGCCAGCTCGGTCAGCATCGCGAGCTCGGCCTCGTCATCGACAGACGCGACCACGTTGTCTCGG
CACTCGGCCAACACCGACGACGGGGGCTCGACCCGCGAGTCTACGCCCGTCGGCTTGAAGTCGATGGGGACCGCC
GCCAAGCCCACGGACGACAGGTATCTACACAGCCAGATCGAAGATCTCCTGACGGCCTTGAGCGAGCTGCAGCGC
AACAACAGCCTCGTCACGAACCAACTTCAGTGGGAGCGGGAAGAACGGGCGGAGGATCGCAAGGCGGTCCGGTTG
CTCCTTGGTGAACTCCGGAAGAGGGCTGCCACCATGTTGCCTGACACGATGACGGCAGAATGTGATGCGGACGAG
AGGGAGTCCTCCCCGGTAGAAGACGAGGTCGATGAGGAAGCTGCGTCGGTCGAGGACGATGCCGATGAAACTGCT
TCGCCCGCAGAGGGCCAGGCACTTGAAGAAGCTGCGGCTTCGGCGGAGGGCGAGGCTGATGGAGATACGGCTTCA
GTGGAGGGCGAGGCTGGTGAAGAAGCTACGGCTTCAGTAAAGGGCGAAGCTGATGACGTCACGGCGCCAGTGGAG
AGCGATGCTGATGAAGAAACGCCGCTGGCGGAAGACAAGGGACCCGAGCTCACCGTGGACGCGCAAGAGCCTGCT
TGGACCAAGGAGATTTCCGATCTCGTGGAACGGGTGGAGAGACGGTTCCGAAGCGACAAGGAGCAACAGCATTCG
TCGATACTACTGTCCAAATCGCAGCTCAGGGATGAGCTGCGCAGCGCGCAAGACCAGCTGGCGAGCGCGGCCTGC
CAATCTCAGGACCTGAGCCGGCGGATCCACGACATGGACCAGGAGACGGCATCACTCAAAGAGCAGCTCCGCGAA
AGGCACAACCAAGTGCGGACGCTTCACCAAGAGAAGCAAAGGTTGGAGAAACAGGTGCAGGCAATGCGCTGCCGG
GGCTCGGCCGGCTCACCAACCGACGGTGCCAGTCGGGACTCGGAGATGGACTTTGTCACCAGAGCCATCCCGGCG
GGCTTGAGAGAGCTGAAGCTGGGGCGCAGCCAGTCGATAACGTCGCCAGTATCGGCGTTTTGCAAGAGAGGCTCC
TCTCTGTCTCGGTTTCCGGACACAGCGCCGCAGTCGAGGTCGCTGGGCGGAACGCCGGCTGCCAGCGAGCACGAG
GCGCTGCTGCTGGAACTCGTGCAAGCCAAGACGGCGGAAGCCATGGCGAAGCAGGAGGCAGAGGAGGCCAAGCAG
AAGCTCGAGGCGATGCGCAAGTCTTCGAGCCCGGCAGAGTCCGGGACCAGCGCGGCACCGACGCCATCCAACACT
ACGCTCGGGATGCTCAGCCGCTTGACGGGTCACGGAAACACGGAACAGGGCGGCAAGGCGGCCGTCGCCACGACA
CCGAGCGCTTCGACGGCCGGCGGCGGATTCTGGTCTCGACTGCTGTGA
Gene >Ophcf2|04146
ATGGCAACGGCGCCGGCCGACGACCATGACATATGCCCTCATAACTCCTCGGGGCCTGCAGCCGCCGCCGCTGAC
GAGCCGGCCTCCGTCCGTGCCAACATGGCCCACGACTCCATGGTGACTGTCAGGCTCTCTGGATCCGCCTCTTCC
GTCGACGCCGCCGCCCCCGAGAGCACCCAGCCCGAGACCGACTGCGACCACGTGGACGTCACCGAAAACCTACGA
CACTCACGCCCCGACTCATCGGTCACGCTATCGCCAACCACCTCCGCCCACGACGACATGGCACTGCCCGGAAAC
GACAGCGACTCCTTCGAGGACGCCGAAGAGGTCAACTGGGCCGAGCTCGAAAAGACCGAAGACGAGCAGGTCAAG
GACGACGAGACGGACAATGTGATTGCCCCTCCCTTCCATTCCCTCCCATTCCCTCTCCTCCCCTCCCATCCCATT
TCATCTCACCTCATCACCCCCCCGACCCCCAATATTCTCAGCCACCAACATATTGACTTGTTGACAGTCGACCGC
TCTTCTCCTCGCTCGCCTCGAGCAGGAAAACGCAAAGTTGGCAACCAATCCAAAGAGTGTCAAGGTCCAGGCCGT
GGACAAGGCCATCTCCGCCAACCCCCGGTCGCCCTCCATGGCTCAGCTTCGACAGATGATGAAGGGGCCCACGCC
GCCCGCCTTGCGGTACTCGATGCTTCCCCCGCCCCCCATGACGGACCTCGAGTTCTACGCGGCCCTCGTCAAGGA
CTATCAGCAGACGGCCGCACGCCTCCCGACCCTGTTGTCTAACAAGATCCGCAAAGGCATCCCTCCGCCGCTGAG
GGGCGTCGTATGGCAGAGCATGTCCGGCGCCCGTGACGCCCTCCTCGAGGAGCAGTACGATACTTTCAGCAACGA
AGCTAGCCCCTATGAGCTTCTGATTGGAAAAGACCTCGGTAGAAGTTTTCCCGGCGTCGACATGTTTCGAGACTC
CGACGGCGATGGGCAGCGCATGCTGGGGCGCGTGCTCAAGAGCTTCAGCCTCTACGATGCCAAGATTGGCTACTG
TCAGGGCCTCGCCTTCCTCGTCGGCCCTCTGCTGATGCATATGCCCGATAAGCAGGCGTTCTGTGTTCTGGTCCG
GCAAGTATACGCTCGGGACGATGGCATCTAGAGGACGGGTCGCTAATGACACATGTTCTAGGTTGATGGAGAGAT
ACGACCTGCGGGCTTGCTTTCTCCCAGATCTCTCCGGTCTTCACGTTCGCATCTTCCAATTCCGAGAGCTGCTCC
GGCTCAACTTTCCTGTGCTATCGACCCATCTGGAAGACCTGCAGGTGGAGACGGCCTATGTTTCGCAGTGGTTCC
TCAGCTTCTTTGCCGTAACATGTCCCCTGCCTATGCTGTTCCGGATCTACGACGTCATATTCGCCGAAGGTGCTT
CCGAGACCCTGATGCGCGTCGCTCTCTCCCTCATGAGAAAGAACGAGGCGCGCCTCTTGGCCTGCACCGAGCTGG
AAGACGTCATGCAGCTTCTCTTATCCCGAGGCCTGTGGGACTGCTACCACTACGACGCCGACGACTTCGTCCAAG
ACTTTGTCAGCCTGACGGGCGTCGTCACGAGGGAGAAGCTAGCCCAGCTAGAGCAGGGATACCGGGAATCGCAGG
TAGCGACTTTGAGCGCCACCCGGGCGTCCGACATCACCACGGCCGCGACCCGTTTCCTCGGCCGCATCTGGGCGT
CGTCGACGGGGAACAAGACGTCGACGCTTCAGCCCGGTCAAGGGGCCCCTCCGCGGCCGCTCAGCATGCTGCGGC
GCAGCACGTCCAAGCAGAGCCTGGCATCGACGCTCTACTCGATGGAGGCCAGCTCGGTCAGCATCGCGAGCTCGG
CCTCGTCATCGACAGACGCGACCACGTTGTCTCGGCACTCGGCCAACACCGACGACGGGGGCTCGACCCGCGAGT
CTACGCCCGTCGGCTTGAAGTCGATGGGGACCGCCGCCAAGCCCACGGACGACAGGTATCTACACAGCCAGATCG
AAGATCTCCTGACGGCCTTGAGCGAGCTGCAGCGCAACAACAGCCTCGTCACGAACCAACTTCAGTGGGAGCGGG
AAGAACGGGCGGAGGATCGCAAGGCGGTCCGGTTGCTCCTTGGTGAACTCCGGAAGAGGGCTGCCACCATGTTGC
CTGACACGATGACGGCAGAATGTGATGCGGACGAGAGGGAGTCCTCCCCGGTAGAAGACGAGGTCGATGAGGAAG
CTGCGTCGGTCGAGGACGATGCCGATGAAACTGCTTCGCCCGCAGAGGGCCAGGCACTTGAAGAAGCTGCGGCTT
CGGCGGAGGGCGAGGCTGATGGAGATACGGCTTCAGTGGAGGGCGAGGCTGGTGAAGAAGCTACGGCTTCAGTAA
AGGGCGAAGCTGATGACGTCACGGCGCCAGTGGAGAGCGATGCTGATGAAGAAACGCCGCTGGCGGAAGACAAGG
GACCCGAGCTCACCGTGGACGCGCAAGAGCCTGCTTGGACCAAGGAGATTTCCGATCTCGTGGAACGGGTGGAGA
GACGGTTCCGAAGCGACAAGGAGCAACAGCATTCGTCGATACTACTGTCCAAATCGCAGCTCAGGGATGAGCTGC
GCAGCGCGCAAGACCAGCTGGCGAGCGCGGCCTGCCAATCTCAGGACCTGAGCCGGCGGATCCACGACATGGACC
AGGAGACGGCATCACTCAAAGAGCAGCTCCGCGAAAGGCACAACCAAGTGCGGACGCTTCACCAAGAGAAGCAAA
GGTTGGAGAAACAGGTGCAGGCAATGCGCTGCCGGGGCTCGGCCGGCTCACCAACCGACGGTGCCAGTCGGGACT
CGGAGATGGACTTTGTCACCAGAGCCATCCCGGCGGGCTTGAGAGAGCTGAAGCTGGGGCGCAGCCAGTCGATAA
CGTCGCCAGTATCGGCGTTTTGCAAGAGAGGCTCCTCTCTGTCTCGGTTTCCGGACACAGCGCCGCAGTCGAGGT
CGCTGGGCGGAACGCCGGCTGCCAGCGAGCACGAGGCGCTGCTGCTGGAACTCGTGCAAGCCAAGACGGCGGAAG
CCATGGCGAAGCAGGAGGCAGAGGAGGCCAAGCAGAAGCTCGAGGCGATGCGCAAGTCTTCGAGCCCGGCAGAGT
CCGGGACCAGCGCGGCACCGACGCCATCCAACACTACGCTCGGGATGCTCAGCCGCTTGACGGGTCACGGAAACA
CGGAACAGGGCGGCAAGGCGGCCGTCGCCACGACACCGAGCGCTTCGACGGCCGGCGGCGGATTCTGGTCTCGAC
TGCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail