Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04145
Gene name
Locationscaffold_04:972039..975768
Strand-
Gene length (bp)3729
Transcript length (bp)3510
Coding sequence length (bp)3510
Protein length (aa) 1170

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00520 Ion_trans Ion transport protein 2.2E-06 372 576

GO

GO Term Description Terminal node
GO:0005216 ion channel activity Yes
GO:0016020 membrane Yes
GO:0006811 ion transport Yes
GO:0055085 transmembrane transport Yes
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0015267 channel activity No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0015075 ion transmembrane transporter activity No
GO:0051179 localization No
GO:0022857 transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022803 passive transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 355 372 17
2 379 401 22
3 416 438 22
4 451 473 22
5 483 505 22
6 517 536 19
7 546 568 22
8 597 619 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 35.13 19.97 50.30
Alive In ants, during behavior modification 52.78 26.52 79.04
Dead In ants, recently dead 51.64 28.35 74.92

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.042612 yes
Alive Dead 0.925581 no
Dead Fungus 0.041312 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04145
MFSLRPKKGSRRVDIRDLSPSASSRFLPRHRINNRPHATADFTEADDDEDEDDEDEDDNDEDDDDQQDGDESTQG
PSHGRARDAQAGDDNGRKGLPVLPLFSATHLDALPIYNITHAIRIIVSARTETSLTWEQLRSPQISQFLVKPMQQ
QIRSQHFSRATLYALMANCLQFNKEGQRYAANAGISNTRAKVCELLALKLLKEYTIRELIDALAYDFYPLQGLPR
AQAPLPQTRNQARAKQALTASRTSTLEVAIRASAKHFLAHPVVVQQLEAIWNGAIIFYSTADRLHREPPSNNING
GPAAPDSRTPLLGSILPKQAQPSGPPGRRTVMLYDPRQASMLKLSRLRVPRYRSFLSTLSLAVLIGLFLAVLVQR
SVQITALELVFWFWSAGFMLDELVGFNEQGFALYIMSFWNIFDLGILVLLIAYYFMRAYGVFLVDPHHWNAMAYD
VLAANAILLLPRIFSILDHYQYFSQLLIALRLMAVDLAAVFVLVLIMCSGFYVFFTLSQSANDGGDVAYKIFQIL
MGFTPAAWDVWPQYNWLARLLMMMFLIICHFLIVTILITVLTNSFMTIASNANEEHQFLFAINTISMVKNDALFS
YVAPSNIFAWLLMPLRYCIPLRHFVWLNRTIIKITHLPVLFCIYLYERFWLAPSMYEPTDLVENHGRSRQRTISF
RDPVERTAMFSPNVRMREESVAGFHKDRALEEVFRRAPEASTLRTQRRNERRKTQTAIRNWMDQNDDAGQPSNWP
TLDSRAVPEWHRRLSVGWDRASHLRQVSDVRSTASDPADFLSMSNHGALLASGKGSRLNVVAADYNHQTDADGDD
ELLTNDDDEEEEEEEEEEEEEEDEAGTNADRGHEGHERLGVEEDDYFTRRPAAKATSSGESPAAQKAALTPAMTG
KRGATSTAAGHSRSVSTNTILYKPEVKVRASSSSSSKSPPRVTAMRKSAATPSGRNTGTNTPAGRRTSPRRAVVM
ASSQPRPIIGARGLTETGGVSRTAMLSLDPHDRLRGTNRRLSSVDLSVLSDNFGVDDAAGVMAGSFQTQMAMAMM
KDNRLRAAGGVDVADRDRMGRLVLARMKTLEESFADVIKEMRDLKNSSTAPHSRRNSSGEEPRAPADGQEQRKRA
TRGDATPRRTGKRPVSRWSMKEGKVGLAAKGESSKGKGKGLRAR*
Coding >Ophcf2|04145
ATGTTTTCCCTTCGCCCTAAGAAGGGCTCCCGGCGCGTTGATATCCGGGACCTCAGCCCGTCGGCCTCGTCGCGA
TTTCTGCCTCGACATCGCATCAATAACCGTCCTCATGCCACGGCAGACTTTACTGAGGCGGACGACGACGAAGAT
GAGGACGATGAGGACGAAGACGATAATGACGAAGACGACGACGACCAGCAAGATGGCGACGAATCCACTCAAGGG
CCTTCCCATGGTCGCGCTCGCGACGCGCAAGCAGGCGACGATAACGGCCGCAAGGGCCTGCCCGTTCTCCCTCTT
TTTTCCGCCACGCATCTCGACGCGCTTCCCATCTACAACATCACCCACGCCATCCGCATCATCGTCAGCGCTCGA
ACCGAGACGTCCTTGACGTGGGAGCAGCTACGCTCGCCCCAGATTTCGCAGTTTCTCGTCAAGCCGATGCAACAA
CAGATTCGCAGCCAACACTTTTCTCGCGCCACTCTCTATGCTCTCATGGCCAACTGCCTGCAATTCAACAAGGAG
GGCCAGCGATACGCGGCCAACGCTGGCATCAGTAACACGAGGGCCAAGGTCTGCGAACTGCTCGCGCTCAAGCTG
CTCAAGGAGTACACCATTCGAGAGTTGATTGATGCCCTCGCCTACGACTTTTATCCCCTACAGGGACTTCCGCGA
GCGCAAGCCCCCCTCCCTCAGACGAGGAACCAGGCCAGGGCGAAACAGGCTCTGACTGCGTCTCGGACATCGACG
CTCGAGGTGGCGATCCGCGCCTCGGCCAAGCACTTCCTCGCCCACCCCGTCGTGGTCCAGCAACTCGAGGCAATC
TGGAACGGCGCCATCATCTTCTACTCGACCGCCGACCGCTTACACCGCGAGCCCCCATCCAACAACATCAACGGG
GGACCCGCCGCGCCCGACTCCCGGACTCCCTTGCTCGGATCCATCCTGCCCAAGCAAGCCCAGCCCTCTGGCCCT
CCGGGCAGGAGGACGGTAATGCTCTATGATCCCCGCCAGGCGTCGATGCTCAAGCTGTCTCGCCTCCGCGTGCCA
CGCTATCGATCCTTCCTTTCCACCCTGTCTCTCGCCGTCCTCATCGGCCTCTTCCTGGCCGTTCTTGTCCAGAGA
TCTGTGCAGATCACGGCACTGGAACTCGTCTTTTGGTTCTGGAGTGCCGGCTTCATGTTGGACGAGCTGGTTGGC
TTCAACGAGCAGGGTTTTGCTCTCTATATCATGAGCTTCTGGAATATCTTTGACCTGGGCATTCTCGTCCTGCTC
ATTGCCTACTACTTCATGCGCGCCTATGGCGTCTTCCTCGTCGATCCCCATCACTGGAACGCCATGGCGTACGAC
GTGTTGGCCGCCAACGCCATCTTGCTGCTGCCACGCATCTTCAGCATCCTCGACCACTACCAGTACTTTTCTCAG
CTGCTCATAGCCCTACGCCTCATGGCGGTGGACCTGGCCGCCGTCTTTGTCCTGGTGCTCATCATGTGCAGCGGC
TTCTACGTCTTCTTCACCCTTTCGCAGAGCGCCAACGACGGCGGCGACGTTGCTTACAAGATCTTTCAGATCCTC
ATGGGCTTCACCCCGGCGGCCTGGGACGTCTGGCCTCAGTATAACTGGCTCGCCAGACTCTTGATGATGATGTTT
CTGATCATTTGTCACTTTCTCATCGTAACGATACTGATCACTGTCCTGACCAACTCTTTCATGACGATTGCCTCC
AACGCCAACGAGGAGCATCAGTTTCTGTTCGCCATCAACACAATCTCAATGGTCAAAAACGACGCCCTCTTTTCC
TACGTGGCGCCGAGCAACATCTTTGCCTGGCTGCTCATGCCCCTTCGGTACTGCATACCGCTGAGGCATTTTGTC
TGGCTGAACCGGACCATTATCAAAATCACCCACTTGCCCGTTCTTTTCTGCATCTATCTATACGAGAGGTTCTGG
CTCGCGCCGTCCATGTATGAGCCGACGGACCTGGTGGAAAACCACGGTAGGTCTCGTCAGAGGACGATTTCCTTC
CGGGACCCTGTCGAGCGGACGGCCATGTTCAGTCCCAACGTGCGGATGAGGGAAGAATCGGTGGCGGGCTTCCAC
AAGGATCGAGCGCTGGAAGAGGTGTTTCGGCGCGCGCCCGAGGCCAGCACGCTGCGGACACAGAGGAGGAACGAG
AGGCGCAAGACGCAGACGGCCATCCGCAACTGGATGGATCAGAACGACGACGCGGGTCAGCCGTCCAACTGGCCG
ACGCTGGACAGCCGAGCGGTGCCAGAGTGGCATCGACGGCTCAGCGTGGGCTGGGACCGGGCTTCGCATCTACGA
CAGGTGTCGGACGTGAGGTCGACGGCAAGCGATCCGGCCGACTTCCTTTCCATGTCGAACCACGGGGCTCTGCTC
GCGTCCGGCAAGGGATCGCGGCTGAACGTGGTAGCTGCCGACTACAATCACCAGACAGATGCGGACGGTGACGAC
GAACTCCTGACGAATGACGACGACGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAAGAGGACGAAGCC
GGAACGAATGCCGACCGGGGCCATGAGGGGCACGAGAGGCTCGGCGTCGAAGAGGACGATTACTTCACGAGACGT
CCGGCGGCCAAGGCAACGTCGTCCGGGGAGTCTCCGGCGGCGCAGAAAGCAGCCCTCACACCGGCCATGACCGGC
AAGCGAGGAGCCACGTCGACGGCAGCAGGCCACAGTCGATCGGTGTCGACCAACACGATCCTGTACAAGCCCGAG
GTCAAGGTGAGAGCCAGCAGCTCTTCGTCATCCAAGTCGCCGCCTCGAGTCACGGCGATGCGGAAGTCGGCAGCT
ACACCAAGCGGGCGCAACACAGGCACCAACACGCCGGCAGGGCGTCGAACATCGCCGCGAAGGGCGGTAGTCATG
GCCAGCTCCCAGCCGAGGCCCATCATCGGAGCGCGCGGCCTGACGGAGACGGGCGGCGTCAGCCGGACAGCCATG
CTCAGCCTGGATCCGCACGACAGGCTTCGGGGGACGAACAGGAGGCTATCGTCGGTGGACCTGAGCGTGCTGTCG
GACAACTTCGGCGTCGACGATGCGGCGGGCGTCATGGCCGGCAGCTTCCAGACGCAGATGGCCATGGCGATGATG
AAGGACAACCGGCTCCGGGCTGCGGGCGGCGTCGACGTGGCAGACCGAGACCGCATGGGCCGTCTGGTGCTCGCG
CGGATGAAGACGCTGGAAGAGAGCTTCGCCGACGTCATCAAAGAGATGCGCGACCTCAAGAACAGCTCCACGGCA
CCGCACTCGAGGCGCAACTCGTCGGGCGAGGAGCCGCGGGCACCAGCCGACGGCCAAGAGCAGCGCAAGCGGGCT
ACCCGCGGCGACGCGACGCCGAGGCGGACGGGGAAGCGGCCCGTCAGCAGATGGAGTATGAAGGAGGGAAAGGTC
GGGCTGGCGGCCAAGGGGGAGTCGTCCAAGGGGAAGGGGAAGGGGTTGCGGGCGAGATGA
Transcript >Ophcf2|04145
ATGTTTTCCCTTCGCCCTAAGAAGGGCTCCCGGCGCGTTGATATCCGGGACCTCAGCCCGTCGGCCTCGTCGCGA
TTTCTGCCTCGACATCGCATCAATAACCGTCCTCATGCCACGGCAGACTTTACTGAGGCGGACGACGACGAAGAT
GAGGACGATGAGGACGAAGACGATAATGACGAAGACGACGACGACCAGCAAGATGGCGACGAATCCACTCAAGGG
CCTTCCCATGGTCGCGCTCGCGACGCGCAAGCAGGCGACGATAACGGCCGCAAGGGCCTGCCCGTTCTCCCTCTT
TTTTCCGCCACGCATCTCGACGCGCTTCCCATCTACAACATCACCCACGCCATCCGCATCATCGTCAGCGCTCGA
ACCGAGACGTCCTTGACGTGGGAGCAGCTACGCTCGCCCCAGATTTCGCAGTTTCTCGTCAAGCCGATGCAACAA
CAGATTCGCAGCCAACACTTTTCTCGCGCCACTCTCTATGCTCTCATGGCCAACTGCCTGCAATTCAACAAGGAG
GGCCAGCGATACGCGGCCAACGCTGGCATCAGTAACACGAGGGCCAAGGTCTGCGAACTGCTCGCGCTCAAGCTG
CTCAAGGAGTACACCATTCGAGAGTTGATTGATGCCCTCGCCTACGACTTTTATCCCCTACAGGGACTTCCGCGA
GCGCAAGCCCCCCTCCCTCAGACGAGGAACCAGGCCAGGGCGAAACAGGCTCTGACTGCGTCTCGGACATCGACG
CTCGAGGTGGCGATCCGCGCCTCGGCCAAGCACTTCCTCGCCCACCCCGTCGTGGTCCAGCAACTCGAGGCAATC
TGGAACGGCGCCATCATCTTCTACTCGACCGCCGACCGCTTACACCGCGAGCCCCCATCCAACAACATCAACGGG
GGACCCGCCGCGCCCGACTCCCGGACTCCCTTGCTCGGATCCATCCTGCCCAAGCAAGCCCAGCCCTCTGGCCCT
CCGGGCAGGAGGACGGTAATGCTCTATGATCCCCGCCAGGCGTCGATGCTCAAGCTGTCTCGCCTCCGCGTGCCA
CGCTATCGATCCTTCCTTTCCACCCTGTCTCTCGCCGTCCTCATCGGCCTCTTCCTGGCCGTTCTTGTCCAGAGA
TCTGTGCAGATCACGGCACTGGAACTCGTCTTTTGGTTCTGGAGTGCCGGCTTCATGTTGGACGAGCTGGTTGGC
TTCAACGAGCAGGGTTTTGCTCTCTATATCATGAGCTTCTGGAATATCTTTGACCTGGGCATTCTCGTCCTGCTC
ATTGCCTACTACTTCATGCGCGCCTATGGCGTCTTCCTCGTCGATCCCCATCACTGGAACGCCATGGCGTACGAC
GTGTTGGCCGCCAACGCCATCTTGCTGCTGCCACGCATCTTCAGCATCCTCGACCACTACCAGTACTTTTCTCAG
CTGCTCATAGCCCTACGCCTCATGGCGGTGGACCTGGCCGCCGTCTTTGTCCTGGTGCTCATCATGTGCAGCGGC
TTCTACGTCTTCTTCACCCTTTCGCAGAGCGCCAACGACGGCGGCGACGTTGCTTACAAGATCTTTCAGATCCTC
ATGGGCTTCACCCCGGCGGCCTGGGACGTCTGGCCTCAGTATAACTGGCTCGCCAGACTCTTGATGATGATGTTT
CTGATCATTTGTCACTTTCTCATCGTAACGATACTGATCACTGTCCTGACCAACTCTTTCATGACGATTGCCTCC
AACGCCAACGAGGAGCATCAGTTTCTGTTCGCCATCAACACAATCTCAATGGTCAAAAACGACGCCCTCTTTTCC
TACGTGGCGCCGAGCAACATCTTTGCCTGGCTGCTCATGCCCCTTCGGTACTGCATACCGCTGAGGCATTTTGTC
TGGCTGAACCGGACCATTATCAAAATCACCCACTTGCCCGTTCTTTTCTGCATCTATCTATACGAGAGGTTCTGG
CTCGCGCCGTCCATGTATGAGCCGACGGACCTGGTGGAAAACCACGGTAGGTCTCGTCAGAGGACGATTTCCTTC
CGGGACCCTGTCGAGCGGACGGCCATGTTCAGTCCCAACGTGCGGATGAGGGAAGAATCGGTGGCGGGCTTCCAC
AAGGATCGAGCGCTGGAAGAGGTGTTTCGGCGCGCGCCCGAGGCCAGCACGCTGCGGACACAGAGGAGGAACGAG
AGGCGCAAGACGCAGACGGCCATCCGCAACTGGATGGATCAGAACGACGACGCGGGTCAGCCGTCCAACTGGCCG
ACGCTGGACAGCCGAGCGGTGCCAGAGTGGCATCGACGGCTCAGCGTGGGCTGGGACCGGGCTTCGCATCTACGA
CAGGTGTCGGACGTGAGGTCGACGGCAAGCGATCCGGCCGACTTCCTTTCCATGTCGAACCACGGGGCTCTGCTC
GCGTCCGGCAAGGGATCGCGGCTGAACGTGGTAGCTGCCGACTACAATCACCAGACAGATGCGGACGGTGACGAC
GAACTCCTGACGAATGACGACGACGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAAGAGGACGAAGCC
GGAACGAATGCCGACCGGGGCCATGAGGGGCACGAGAGGCTCGGCGTCGAAGAGGACGATTACTTCACGAGACGT
CCGGCGGCCAAGGCAACGTCGTCCGGGGAGTCTCCGGCGGCGCAGAAAGCAGCCCTCACACCGGCCATGACCGGC
AAGCGAGGAGCCACGTCGACGGCAGCAGGCCACAGTCGATCGGTGTCGACCAACACGATCCTGTACAAGCCCGAG
GTCAAGGTGAGAGCCAGCAGCTCTTCGTCATCCAAGTCGCCGCCTCGAGTCACGGCGATGCGGAAGTCGGCAGCT
ACACCAAGCGGGCGCAACACAGGCACCAACACGCCGGCAGGGCGTCGAACATCGCCGCGAAGGGCGGTAGTCATG
GCCAGCTCCCAGCCGAGGCCCATCATCGGAGCGCGCGGCCTGACGGAGACGGGCGGCGTCAGCCGGACAGCCATG
CTCAGCCTGGATCCGCACGACAGGCTTCGGGGGACGAACAGGAGGCTATCGTCGGTGGACCTGAGCGTGCTGTCG
GACAACTTCGGCGTCGACGATGCGGCGGGCGTCATGGCCGGCAGCTTCCAGACGCAGATGGCCATGGCGATGATG
AAGGACAACCGGCTCCGGGCTGCGGGCGGCGTCGACGTGGCAGACCGAGACCGCATGGGCCGTCTGGTGCTCGCG
CGGATGAAGACGCTGGAAGAGAGCTTCGCCGACGTCATCAAAGAGATGCGCGACCTCAAGAACAGCTCCACGGCA
CCGCACTCGAGGCGCAACTCGTCGGGCGAGGAGCCGCGGGCACCAGCCGACGGCCAAGAGCAGCGCAAGCGGGCT
ACCCGCGGCGACGCGACGCCGAGGCGGACGGGGAAGCGGCCCGTCAGCAGATGGAGTATGAAGGAGGGAAAGGTC
GGGCTGGCGGCCAAGGGGGAGTCGTCCAAGGGGAAGGGGAAGGGGTTGCGGGCGAGATGA
Gene >Ophcf2|04145
ATGTTTTCCCTTCGCCCTAAGAAGGGCTCCCGGCGCGTTGATATCCGGGACCTCAGCCCGTCGGCCTCGTCGCGA
TTTCTGCCTCGACATCGCATCAATAACCGTCCTCATGCCACGGCAGACTTTACTGAGGCGGACGACGACGAAGAT
GAGGACGATGAGGACGAAGACGATAATGACGAAGACGACGACGACCAGCAAGATGGCGACGAATCCACTCAAGGG
CCTTCCCATGGTCGCGCTCGCGACGCGCAAGCAGGCGACGATAACGGCCGCAAGGGCCTGCCCGTTCTCCCTCTT
TTTTCCGCCACGCATCTCGGTAACTCGCCATCACCCTCCTGTCGCGACGGCATAACACTGACTCGTCTCCAGACG
CGCTTCCCATCTACAACATCACCCACGCCATCCGCATCATCGTCAGCGCTCGAACCGAGACGTCCTTGACGTGGG
AGCAGCTACGCTCGCCCCAGATTTCGCAGTTTCTCGTCAAGCCGATGCAACAACAGATTCGCAGCCAACACTTTT
CTCGCGCCACTCTCTATGCTCTCATGGCCAACTGCCTGCAATTCAACAAGGAGGGCCAGCGATACGCGGCCAACG
CTGGCATCAGTAACACGAGGGCCAAGGTCTGCGAACTGCTCGCGCTCAAGCTGCTCAAGGAGTACACCATTCGAG
AGTTGATTGATGCCCTCGCCTACGACTTTTATCCCCTACAGGGACTTCCGCGAGCGCAAGCCCCCCTCCCTCAGA
CGAGGAACCAGGCCAGGGCGAAACAGGCTCTGACTGCGTCTCGGACATCGACGCTCGAGGTGGCGATCCGCGCCT
CGGCCAAGCACTTCCTCGCCCACCCCGTCGTGGTCCAGCAACTCGAGGCAATCTGGAACGGCGCCATCATCTTCT
ACTCGACCGCCGACCGCTTACACCGCGAGCCCCCATCCAACAACATCAACGGGGGACCCGCCGCGCCCGACTCCC
GGACTCCCTTGCTCGGATCCATCCTGCCCAAGCAAGCCCAGCCCTCTGGCCCTCCGGGCAGGAGGACGGTAATGC
TCTATGATCCCCGCCAGGCGTCGATGCTCAAGCTGTCTCGCCTCCGCGTGCCACGCTATCGATCCTTCCTTTCCA
CCCTGTCTCTCGCCGTCCTCATCGGCCTCTTCCTGGCCGTTCTTGTCCAGAGATCTGTGCAGATCACGGCACTGG
AACTCGTCTTTTGGTTCTGGAGTGCCGGCTTCATGTTGGACGAGCTGGTTGGCTTCAACGAGCAGGGTTTTGCTC
TCTATATCATGAGCTTCTGGAATATCTTTGACCTGGGCATTCTCGTCCTGCTCATTGCCTACTACTTCATGCGCG
CCTATGGCGTCTTCCTCGTCGATCCCCATCACTGGAACGCCATGGCGTACGACGTGTTGGCCGCCAACGCCATCT
TGCTGCTGCCACGCATCTTCAGCATCCTCGACCACTACCAGTACTTTTCTCAGCTGCTCATAGCCCTACGCCTCA
TGGCGGTGGACCTGGCCGCCGTCTTTGTCCTGGTGCTCATCATGTGCAGCGGCTTCTACGTCTTCTTCACCCTTT
CGCAGAGCGCCAACGACGGCGGCGACGTTGCTTACAAGATCTTTCAGATCCTCATGGGCTTCACCCCGGCGGCCT
GGGACGTGTACGTCGGACTTGTCCCATCGAGAGAAGTGATGACGCTGACGCAGAATAACAGCTGGCCTCAGTATA
ACTGGCTCGCCAGACTCTTGATGATGATGTTTCTGATCATTTGTCACTTTCTCATCGTGTAAGTTGTTCCGTTTC
CTCCGACTATGAGTATCAGAGAGAGACTGACTTGAGACGGCCAGAACGATACTGATCACTGTCCTGACCAACTCT
TTCATGACGATTGCCTCCAACGCCAACGAGGAGCATCAGTAAGTGGCCTCGAGCGACGGAGAGACGGATCCGTGC
TAACGAAGGCGCAGGTTTCTGTTCGCCATCAACACAATCTCAATGGTCAAAAACGACGCCCTCTTTTCCTACGTG
GCGCCGAGCAACATCTTTGCCTGGCTGCTCATGCCCCTTCGGTACTGCATACCGCTGAGGCATTTTGTCTGGCTG
AACCGGACCATTATCAAAATCACCCACTTGCCCGTTCTTTTCTGCATCTATCTATACGAGAGGTTCTGGCTCGCG
CCGTCCATGTATGAGCCGACGGACCTGGTGGAAAACCACGGTAGGTCTCGTCAGAGGACGATTTCCTTCCGGGAC
CCTGTCGAGCGGACGGCCATGTTCAGTCCCAACGTGCGGATGAGGGAAGAATCGGTGGCGGGCTTCCACAAGGAT
CGAGCGCTGGAAGAGGTGTTTCGGCGCGCGCCCGAGGCCAGCACGCTGCGGACACAGAGGAGGAACGAGAGGCGC
AAGACGCAGACGGCCATCCGCAACTGGATGGATCAGAACGACGACGCGGGTCAGCCGTCCAACTGGCCGACGCTG
GACAGCCGAGCGGTGCCAGAGTGGCATCGACGGCTCAGCGTGGGCTGGGACCGGGCTTCGCATCTACGACAGGTG
TCGGACGTGAGGTCGACGGCAAGCGATCCGGCCGACTTCCTTTCCATGTCGAACCACGGGGCTCTGCTCGCGTCC
GGCAAGGGATCGCGGCTGAACGTGGTAGCTGCCGACTACAATCACCAGACAGATGCGGACGGTGACGACGAACTC
CTGACGAATGACGACGACGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAAGAGGACGAAGCCGGAACG
AATGCCGACCGGGGCCATGAGGGGCACGAGAGGCTCGGCGTCGAAGAGGACGATTACTTCACGAGACGTCCGGCG
GCCAAGGCAACGTCGTCCGGGGAGTCTCCGGCGGCGCAGAAAGCAGCCCTCACACCGGCCATGACCGGCAAGCGA
GGAGCCACGTCGACGGCAGCAGGCCACAGTCGATCGGTGTCGACCAACACGATCCTGTACAAGCCCGAGGTCAAG
GTGAGAGCCAGCAGCTCTTCGTCATCCAAGTCGCCGCCTCGAGTCACGGCGATGCGGAAGTCGGCAGCTACACCA
AGCGGGCGCAACACAGGCACCAACACGCCGGCAGGGCGTCGAACATCGCCGCGAAGGGCGGTAGTCATGGCCAGC
TCCCAGCCGAGGCCCATCATCGGAGCGCGCGGCCTGACGGAGACGGGCGGCGTCAGCCGGACAGCCATGCTCAGC
CTGGATCCGCACGACAGGCTTCGGGGGACGAACAGGAGGCTATCGTCGGTGGACCTGAGCGTGCTGTCGGACAAC
TTCGGCGTCGACGATGCGGCGGGCGTCATGGCCGGCAGCTTCCAGACGCAGATGGCCATGGCGATGATGAAGGAC
AACCGGCTCCGGGCTGCGGGCGGCGTCGACGTGGCAGACCGAGACCGCATGGGCCGTCTGGTGCTCGCGCGGATG
AAGACGCTGGAAGAGAGCTTCGCCGACGTCATCAAAGAGATGCGCGACCTCAAGAACAGCTCCACGGCACCGCAC
TCGAGGCGCAACTCGTCGGGCGAGGAGCCGCGGGCACCAGCCGACGGCCAAGAGCAGCGCAAGCGGGCTACCCGC
GGCGACGCGACGCCGAGGCGGACGGGGAAGCGGCCCGTCAGCAGATGGAGTATGAAGGAGGGAAAGGTCGGGCTG
GCGGCCAAGGGGGAGTCGTCCAAGGGGAAGGGGAAGGGGTTGCGGGCGAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail