Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04134
Gene name
Locationscaffold_04:939488..941367
Strand+
Gene length (bp)1879
Transcript length (bp)1722
Coding sequence length (bp)1722
Protein length (aa) 574

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 9.3E-20 117 396
PF07690 MFS_1 Major Facilitator Superfamily 2.3E-09 424 547

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

Domain # Start End Length
1 61 80 19
2 120 142 22
3 154 173 19
4 183 205 22
5 218 240 22
6 250 272 22
7 331 353 22
8 373 395 22
9 449 471 22
10 486 508 22
11 515 534 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 128.14 69.64 186.63
Alive In ants, during behavior modification 185.38 92.83 277.94
Dead In ants, recently dead 226.09 111.01 341.17

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.068908 no
Alive Dead 0.325004 no
Dead Fungus 0.006607 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04134
MASSKSVQPRRLGPEEDEADPSGVQTTVTTRLLRADSESDSGRWTGVDDFEGLPWWRKPSVLWLLGPFSLFTLAF
GGTIVPKLNLVLDLVCRRYYADQSTLLAVGVDNPMCRTPEVQKDVATFLLVINLVTGGLSAIVAPKLGHLSDRHG
RRKLLALASCGGLLGEIITVLAAKFPDTVDYRWLVLGAFFDGMTGSFTAGSILSQSYTSDCTPPSRRAVSIGYIQ
ACLFMGLAFGPLLSGYFVKWTGSLLSMFYVAICCHAFFVLFAGFVMPESLSKKRQIAAREKWKRAQEALGTAGVF
SWLSVVKKSNPFIPLRMLWPTGWGTSTRLRLNLLALAICDAIFLGVAFAVGPVLMLYAESMFHWGNFETSRFVSI
LSLTRVFVLMGLLPLINYIGRVRPAARRQKLFGTAPVEKNAGADGLDIWLLRFALIFEVIACVGYTLARDENSFV
ASGLVTALGGLGSATTQAAVTKHMPPELVGQMLGAIGMLHALSRIVGPVVFSGLYAATVKTFPQAVFLALGGLFA
FALVITLVIRPHVHWHESVEEQPRPQPRGLYSTIVQSLPVDEDQVRLQ*
Coding >Ophcf2|04134
ATGGCGTCTTCCAAATCGGTCCAACCCCGTCGTCTCGGGCCCGAAGAAGATGAAGCCGACCCGTCCGGAGTTCAG
ACGACGGTAACCACCCGGCTGCTCCGCGCCGATTCGGAGTCGGATTCCGGCCGCTGGACCGGCGTCGATGATTTC
GAGGGTCTGCCGTGGTGGCGCAAGCCTTCGGTCTTGTGGCTGCTCGGCCCCTTTTCGCTCTTCACTCTTGCCTTT
GGCGGTACCATCGTTCCCAAACTAAACTTGGTGCTGGACCTCGTCTGTAGACGATATTATGCCGATCAGAGCACG
CTTCTCGCCGTCGGCGTCGACAATCCCATGTGCAGAACGCCCGAGGTGCAAAAAGACGTCGCAACCTTTCTGCTC
GTCATCAACCTCGTCACGGGCGGCTTGAGCGCCATCGTCGCTCCCAAACTCGGCCACCTATCCGACCGCCATGGC
CGCCGAAAGCTGCTGGCCTTGGCGTCATGTGGCGGCCTGCTAGGCGAGATCATCACCGTCCTGGCCGCCAAGTTT
CCGGACACGGTCGACTATCGCTGGCTCGTTCTCGGCGCCTTCTTCGACGGCATGACGGGCTCCTTCACCGCCGGC
AGCATCCTCAGTCAGTCGTATACGAGCGACTGCACGCCCCCGTCCAGACGCGCCGTGTCCATCGGATACATCCAG
GCCTGCCTCTTCATGGGCCTGGCCTTTGGTCCTCTGCTGTCCGGCTATTTTGTCAAGTGGACGGGCAGTCTCTTG
TCCATGTTCTATGTCGCCATCTGCTGCCACGCCTTCTTCGTGCTCTTCGCCGGCTTCGTCATGCCCGAGTCTCTG
TCCAAAAAGAGGCAAATAGCGGCCCGAGAAAAGTGGAAGCGCGCACAGGAGGCTCTAGGCACGGCCGGTGTCTTC
TCCTGGCTGTCCGTCGTCAAGAAGTCGAACCCGTTTATTCCCCTGCGGATGTTGTGGCCCACCGGCTGGGGGACG
TCGACACGGCTGCGTCTCAACCTGCTGGCGTTGGCCATCTGCGACGCCATCTTCCTCGGGGTCGCCTTTGCCGTC
GGGCCCGTCCTCATGCTGTACGCCGAGTCCATGTTTCATTGGGGAAACTTTGAGACGTCGCGCTTCGTCTCCATC
TTGTCCTTGACCCGCGTCTTCGTCCTCATGGGGCTGCTGCCGCTCATCAATTACATAGGACGTGTGCGGCCCGCG
GCCCGGCGGCAGAAGCTATTCGGCACGGCTCCGGTAGAGAAGAACGCCGGGGCGGACGGGCTCGACATCTGGCTC
CTCCGCTTCGCCCTGATATTCGAGGTGATTGCCTGTGTAGGCTACACGTTGGCGAGAGACGAGAACTCGTTCGTC
GCCAGCGGCCTGGTCACGGCTCTGGGCGGCCTCGGGAGCGCCACGACACAGGCGGCCGTAACTAAGCACATGCCG
CCGGAGCTGGTGGGCCAGATGCTAGGTGCCATCGGCATGTTACACGCCCTGTCGAGAATCGTCGGCCCCGTCGTC
TTCAGTGGACTGTACGCCGCGACTGTCAAGACGTTTCCGCAGGCCGTCTTCCTCGCTCTCGGCGGCCTGTTTGCC
TTTGCTCTGGTGATTACTCTGGTGATCAGACCGCATGTCCACTGGCACGAATCCGTCGAGGAGCAGCCCAGACCG
CAACCCCGTGGGCTTTACAGCACCATTGTGCAATCGCTGCCCGTCGACGAGGATCAGGTGCGCTTACAGTAA
Transcript >Ophcf2|04134
ATGGCGTCTTCCAAATCGGTCCAACCCCGTCGTCTCGGGCCCGAAGAAGATGAAGCCGACCCGTCCGGAGTTCAG
ACGACGGTAACCACCCGGCTGCTCCGCGCCGATTCGGAGTCGGATTCCGGCCGCTGGACCGGCGTCGATGATTTC
GAGGGTCTGCCGTGGTGGCGCAAGCCTTCGGTCTTGTGGCTGCTCGGCCCCTTTTCGCTCTTCACTCTTGCCTTT
GGCGGTACCATCGTTCCCAAACTAAACTTGGTGCTGGACCTCGTCTGTAGACGATATTATGCCGATCAGAGCACG
CTTCTCGCCGTCGGCGTCGACAATCCCATGTGCAGAACGCCCGAGGTGCAAAAAGACGTCGCAACCTTTCTGCTC
GTCATCAACCTCGTCACGGGCGGCTTGAGCGCCATCGTCGCTCCCAAACTCGGCCACCTATCCGACCGCCATGGC
CGCCGAAAGCTGCTGGCCTTGGCGTCATGTGGCGGCCTGCTAGGCGAGATCATCACCGTCCTGGCCGCCAAGTTT
CCGGACACGGTCGACTATCGCTGGCTCGTTCTCGGCGCCTTCTTCGACGGCATGACGGGCTCCTTCACCGCCGGC
AGCATCCTCAGTCAGTCGTATACGAGCGACTGCACGCCCCCGTCCAGACGCGCCGTGTCCATCGGATACATCCAG
GCCTGCCTCTTCATGGGCCTGGCCTTTGGTCCTCTGCTGTCCGGCTATTTTGTCAAGTGGACGGGCAGTCTCTTG
TCCATGTTCTATGTCGCCATCTGCTGCCACGCCTTCTTCGTGCTCTTCGCCGGCTTCGTCATGCCCGAGTCTCTG
TCCAAAAAGAGGCAAATAGCGGCCCGAGAAAAGTGGAAGCGCGCACAGGAGGCTCTAGGCACGGCCGGTGTCTTC
TCCTGGCTGTCCGTCGTCAAGAAGTCGAACCCGTTTATTCCCCTGCGGATGTTGTGGCCCACCGGCTGGGGGACG
TCGACACGGCTGCGTCTCAACCTGCTGGCGTTGGCCATCTGCGACGCCATCTTCCTCGGGGTCGCCTTTGCCGTC
GGGCCCGTCCTCATGCTGTACGCCGAGTCCATGTTTCATTGGGGAAACTTTGAGACGTCGCGCTTCGTCTCCATC
TTGTCCTTGACCCGCGTCTTCGTCCTCATGGGGCTGCTGCCGCTCATCAATTACATAGGACGTGTGCGGCCCGCG
GCCCGGCGGCAGAAGCTATTCGGCACGGCTCCGGTAGAGAAGAACGCCGGGGCGGACGGGCTCGACATCTGGCTC
CTCCGCTTCGCCCTGATATTCGAGGTGATTGCCTGTGTAGGCTACACGTTGGCGAGAGACGAGAACTCGTTCGTC
GCCAGCGGCCTGGTCACGGCTCTGGGCGGCCTCGGGAGCGCCACGACACAGGCGGCCGTAACTAAGCACATGCCG
CCGGAGCTGGTGGGCCAGATGCTAGGTGCCATCGGCATGTTACACGCCCTGTCGAGAATCGTCGGCCCCGTCGTC
TTCAGTGGACTGTACGCCGCGACTGTCAAGACGTTTCCGCAGGCCGTCTTCCTCGCTCTCGGCGGCCTGTTTGCC
TTTGCTCTGGTGATTACTCTGGTGATCAGACCGCATGTCCACTGGCACGAATCCGTCGAGGAGCAGCCCAGACCG
CAACCCCGTGGGCTTTACAGCACCATTGTGCAATCGCTGCCCGTCGACGAGGATCAGGTGCGCTTACAGTAA
Gene >Ophcf2|04134
ATGGCGTCTTCCAAATCGGTCCAACCCCGTCGTCTCGGGCCCGAAGAAGATGAAGCCGACCCGTCCGGAGTTCAG
ACGACGGTAACCACCCGGCTGCTCCGCGCCGATTCGGAGTCGGATTCCGGCCGCTGGACCGGCGTCGATGATTTC
GAGGGTCTGCCGTGGTGGCGCAAGCCTTCGGTATATCCTCTGCTGGCGCTGGAGATTCCCATAGGCTGATGCACG
AGGCCAGGTCTTGTGGCTGCTCGGCCCCTTTTCGCTCTTCACTCTTGCCTTTGGCGGTACCATCGTTCCCAAACT
AAACTTGTGAGCCTTGTTCTGCGCCGACTCAACTCTAGCCGTTCTGACCGTTCACAAGGGTGCTGGACCTCGTCT
GTAGACGATATTATGCCGATCAGAGCACGCTTCTCGCCGTCGGCGTCGACAATCCCATGTGCAGAACGCCCGAGG
TGCAAAAAGACGTCGCAACCTTTCTGCTCGTCATCAACCTCGTCACGGGCGGCTTGAGCGCCATCGTCGCTCCCA
AACTCGGCCACCTATCCGACCGCCATGGCCGCCGAAAGCTGCTGGCCTTGGCGTCATGTGGCGGCCTGCTAGGCG
AGATCATCACCGTCCTGGCCGCCAAGTTTCCGGACACGGTCGACTATCGCTGGCTCGTTCTCGGCGCCTTCTTCG
ACGGCATGACGGGCTCCTTCACCGCCGGCAGCATCCTCAGTCAGTCGTATACGAGCGACTGCACGCCCCCGTCCA
GACGCGCCGTGTCCATCGGATACATCCAGGCCTGCCTCTTCATGGGCCTGGCCTTTGGTCCTCTGCTGTCCGGCT
ATTTTGTCAAGTGGACGGGCAGTCTCTTGTCCATGTTCTATGTCGCCATCTGCTGCCACGCCTTCTTCGTGCTCT
TCGCCGGCTTCGTCATGCCCGAGTCTCTGTCCAAAAAGAGGCAAATAGCGGCCCGAGAAAAGTGGAAGCGCGCAC
AGGAGGCTCTAGGCACGGCCGGTGTCTTCTCCTGGCTGTCCGTCGTCAAGAAGTCGAACCCGTTTATTCCCCTGC
GGATGTTGTGGCCCACCGGCTGGGGGACGTCGACACGGCTGCGTCTCAACCTGCTGGCGTTGGCCATCTGCGACG
CCATCTTCCTCGGGGTCGCCTTTGCCGTCGGGCCCGTCCTCATGCTGTACGCCGAGTCCATGTTTCATTGGGGAA
ACTTTGAGACGTCGCGCTTCGTCTCCATCTTGTCCTTGACCCGCGTCTTCGTCCTCATGGGGCTGCTGCCGCTCA
TCAATTACATAGGACGTGTGCGGCCCGCGGCCCGGCGGCAGAAGCTATTCGGCACGGCTCCGGTAGAGAAGAACG
CCGGGGCGGACGGGCTCGACATCTGGCTCCTCCGCTTCGCCCTGATATTCGAGGTGATTGCCTGTGTAGGCTACA
CGTTGGCGAGAGACGAGAACTCGTTCGTCGCCAGCGGCCTGGTCACGGCTCTGGGCGGCCTCGGGAGCGCCACGA
CACAGGCGGCCGTAACTAAGCACATGCCGCCGGAGCTGGTGGGCCAGATGCTAGGTGCCATCGGCATGTTACACG
CCCTGTCGAGAATCGTCGGCCCCGTCGTCTTCAGTGGACTGTACGCCGCGACTGTCAAGACGTTTCCGCAGGCCG
TCTTCCTCGCTCTCGGCGGCCTGTTTGCCTTTGCTCTGGTGATTACTCTGGTGATCAGACCGCATGGTATGTGCT
GCTGATAGATCTTTACCTTTGTAATGACGGCTGACTCTCGACAGTCCACTGGCACGAATCCGTCGAGGAGCAGCC
CAGACCGCAACCCCGTGGGCTTTACAGCACCATTGTGCAATCGCTGCCCGTCGACGAGGATCAGGTGCGCTTACA
GTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail