Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04133
Gene name
Locationscaffold_04:936339..938759
Strand-
Gene length (bp)2420
Transcript length (bp)2361
Coding sequence length (bp)2361
Protein length (aa) 787

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11831 Myb_Cef pre-mRNA splicing factor component 5.4E-48 422 627
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 9.4E-11 7 52
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 7.5E-10 60 102
PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain 9.5E-15 9 69
PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain 3.4E-07 61 102

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1782 0.9469 0.0143 0.0131 0.0562 0.0014 0.0345 0.009 0.0086 0.0015

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2835
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3222
Ophiocordyceps australis map64 (Brazil) OphauB2|3871
Ophiocordyceps camponoti-floridani Ophcf2|04133 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1202
Ophiocordyceps kimflemingae Ophio5|7025
Ophiocordyceps subramaniannii Hirsu2|4626

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04133
MPVVKGGVWTNIEDEILKASVSKYGLNQWARVSSLLARKTPKQCKARWNEWLDPSIKKIEWSKEEDEKLLHLAKI
MPTQWRTIAPIVGRTANQCLERYQKLLDEAEAHESSSLDLAGPQGPETQAPSAQDLRRLRPGELDPDPETKPARP
DTIDLDEDEKEMLSEARARLANTQGKKAKRKARERQQEESRRLASLQKRRELKTAGINIKITNRKKGEMDYNADI
PFEKPAAPGFYDTTEEQARNDLQRLAVDPRKQHLATKRKGDDDSDGDRKRRRNDKEGLSDSQKAALRAGQMQKLR
EAEQNSKRRALNLPAPQVSDGELEEIIKMGKMGEAASNMARESDNEATKGFINPYSALNANAPIRTPKAPAQEDH
IANEIRNIRALNETQSALLGGENTPLHEGAASTGFEGIAPRKQTVATPNPMATPLRAGGVGATPGRQTPLRTPRD
TFSLNRGDGDATPSASATPRDLRRREAAMRDQLRTGLASLPKPKDSEWEFELPDGQQEPSGLSDQQRQEDAAERD
RRERHRRAAEEELALRRRTQVMQRALPRPLSVHFAQLARAAEETTDSARALIAREVAVLVADDASKYPLPGSRLS
GGPAPAPEQMDDGALADARLAILSETKPRPGLDAVQSLFQSRARDSTLLGLGCYDDDDDDDDDDDDEQRQEAAMR
SAFDAVQDSIMASAETGAKLEKKLALHLGGYQKRQRLLRDSMMEKADALSRARNALAGYRVLAAAEEVALEARLE
KRRADVAFVAGRMRAAQERHRRASEELDELMDVNGF*
Coding >Ophcf2|04133
ATGCCGGTGGTCAAGGGAGGCGTCTGGACCAACATCGAGGACGAGATCCTCAAGGCCTCGGTCTCCAAATATGGA
CTCAACCAGTGGGCCCGCGTCTCCTCGTTGCTGGCGCGGAAGACGCCCAAGCAGTGCAAAGCCCGATGGAACGAA
TGGCTCGATCCCAGCATCAAGAAGATCGAGTGGAGCAAGGAAGAGGACGAGAAGCTGCTGCATCTAGCCAAGATC
ATGCCCACTCAGTGGCGCACCATCGCCCCCATCGTCGGCCGCACCGCCAATCAGTGCCTCGAGCGCTATCAGAAG
CTGCTTGACGAGGCAGAGGCTCACGAGTCTTCGTCCCTCGACCTCGCCGGTCCCCAAGGTCCCGAGACTCAGGCT
CCCAGCGCCCAGGACTTGAGGCGGTTGCGCCCGGGAGAGCTCGACCCGGATCCGGAGACGAAGCCGGCTCGACCC
GATACCATCGACCTCGATGAGGATGAAAAGGAGATGCTTAGCGAGGCACGCGCCCGTCTCGCCAACACACAGGGT
AAAAAGGCCAAGCGCAAGGCCCGCGAGCGTCAGCAGGAGGAGTCACGCCGTCTGGCTTCTCTGCAGAAGCGGAGG
GAGCTCAAGACGGCCGGCATCAACATCAAGATTACCAACCGCAAGAAGGGCGAGATGGACTACAATGCAGACATC
CCCTTTGAGAAGCCAGCCGCGCCGGGCTTCTACGACACGACGGAAGAGCAGGCCCGCAATGATCTGCAACGTCTG
GCCGTCGATCCCCGCAAGCAACACCTCGCCACCAAGCGCAAGGGTGACGACGACAGTGATGGCGACCGCAAGAGG
CGCAGGAACGACAAGGAAGGTCTTTCGGACTCGCAAAAGGCGGCACTCCGAGCCGGGCAGATGCAGAAGCTGCGC
GAGGCCGAGCAGAACAGCAAGCGACGGGCGCTCAACCTCCCGGCTCCGCAGGTCAGCGACGGCGAGCTCGAGGAG
ATTATCAAGATGGGCAAGATGGGCGAGGCGGCCAGCAACATGGCCAGGGAGAGCGACAATGAGGCGACAAAGGGC
TTCATCAACCCGTACTCGGCGCTCAACGCCAACGCGCCCATCCGGACACCCAAGGCGCCAGCGCAGGAGGATCAC
ATCGCCAACGAGATTCGCAATATTCGTGCGCTCAACGAGACTCAATCGGCGCTGCTCGGTGGCGAGAACACGCCG
CTACACGAGGGCGCGGCCTCGACGGGCTTCGAAGGTATCGCGCCCCGGAAGCAGACGGTGGCGACGCCCAATCCC
ATGGCCACGCCCCTGAGGGCCGGCGGGGTGGGAGCCACTCCGGGCCGGCAGACGCCGCTTCGGACGCCACGCGAC
ACGTTCTCTCTGAACCGGGGCGACGGCGATGCGACTCCCTCGGCATCGGCCACACCCCGAGACCTGCGACGACGC
GAGGCGGCGATGCGGGACCAGCTCCGGACGGGTCTCGCGTCGTTGCCGAAGCCCAAAGACAGCGAATGGGAGTTT
GAGCTGCCCGACGGCCAGCAAGAGCCCAGCGGATTGTCGGACCAACAGCGGCAAGAGGACGCAGCCGAGCGCGAC
AGACGAGAGCGCCATCGGCGAGCGGCAGAGGAGGAGTTGGCCCTGCGGCGAAGGACTCAGGTGATGCAGCGGGCA
CTTCCCAGGCCACTCTCGGTCCATTTCGCGCAGCTGGCGAGGGCTGCTGAAGAGACTACGGACTCGGCTCGGGCT
CTCATCGCCAGGGAGGTGGCCGTGCTCGTGGCTGACGACGCGTCCAAGTATCCGCTTCCCGGGTCACGACTCAGC
GGCGGTCCGGCCCCGGCTCCGGAGCAGATGGACGACGGAGCGCTGGCCGATGCTCGTCTCGCCATTCTCTCCGAG
ACCAAGCCCCGACCCGGACTCGACGCGGTGCAGTCTCTCTTCCAGTCTCGCGCTCGGGACTCGACGCTCCTCGGC
CTCGGCTGCTACGACGACGACGACGACGACGACGACGACGACGATGATGAGCAACGGCAAGAAGCAGCCATGCGC
TCCGCCTTTGACGCTGTACAAGACTCCATCATGGCGTCGGCCGAGACGGGCGCCAAGCTGGAGAAGAAGCTGGCC
CTCCACCTCGGCGGCTACCAGAAACGTCAGCGTCTTCTCCGCGACAGCATGATGGAAAAGGCCGACGCACTGTCC
CGCGCCCGCAACGCGCTGGCCGGCTACCGGGTTCTGGCGGCCGCAGAGGAGGTGGCGCTGGAGGCAAGGCTCGAG
AAGCGGCGGGCCGACGTGGCGTTTGTGGCGGGTAGGATGAGGGCTGCTCAGGAGAGGCATCGGAGGGCGAGTGAA
GAGCTCGATGAGTTGATGGATGTGAATGGTTTCTGA
Transcript >Ophcf2|04133
ATGCCGGTGGTCAAGGGAGGCGTCTGGACCAACATCGAGGACGAGATCCTCAAGGCCTCGGTCTCCAAATATGGA
CTCAACCAGTGGGCCCGCGTCTCCTCGTTGCTGGCGCGGAAGACGCCCAAGCAGTGCAAAGCCCGATGGAACGAA
TGGCTCGATCCCAGCATCAAGAAGATCGAGTGGAGCAAGGAAGAGGACGAGAAGCTGCTGCATCTAGCCAAGATC
ATGCCCACTCAGTGGCGCACCATCGCCCCCATCGTCGGCCGCACCGCCAATCAGTGCCTCGAGCGCTATCAGAAG
CTGCTTGACGAGGCAGAGGCTCACGAGTCTTCGTCCCTCGACCTCGCCGGTCCCCAAGGTCCCGAGACTCAGGCT
CCCAGCGCCCAGGACTTGAGGCGGTTGCGCCCGGGAGAGCTCGACCCGGATCCGGAGACGAAGCCGGCTCGACCC
GATACCATCGACCTCGATGAGGATGAAAAGGAGATGCTTAGCGAGGCACGCGCCCGTCTCGCCAACACACAGGGT
AAAAAGGCCAAGCGCAAGGCCCGCGAGCGTCAGCAGGAGGAGTCACGCCGTCTGGCTTCTCTGCAGAAGCGGAGG
GAGCTCAAGACGGCCGGCATCAACATCAAGATTACCAACCGCAAGAAGGGCGAGATGGACTACAATGCAGACATC
CCCTTTGAGAAGCCAGCCGCGCCGGGCTTCTACGACACGACGGAAGAGCAGGCCCGCAATGATCTGCAACGTCTG
GCCGTCGATCCCCGCAAGCAACACCTCGCCACCAAGCGCAAGGGTGACGACGACAGTGATGGCGACCGCAAGAGG
CGCAGGAACGACAAGGAAGGTCTTTCGGACTCGCAAAAGGCGGCACTCCGAGCCGGGCAGATGCAGAAGCTGCGC
GAGGCCGAGCAGAACAGCAAGCGACGGGCGCTCAACCTCCCGGCTCCGCAGGTCAGCGACGGCGAGCTCGAGGAG
ATTATCAAGATGGGCAAGATGGGCGAGGCGGCCAGCAACATGGCCAGGGAGAGCGACAATGAGGCGACAAAGGGC
TTCATCAACCCGTACTCGGCGCTCAACGCCAACGCGCCCATCCGGACACCCAAGGCGCCAGCGCAGGAGGATCAC
ATCGCCAACGAGATTCGCAATATTCGTGCGCTCAACGAGACTCAATCGGCGCTGCTCGGTGGCGAGAACACGCCG
CTACACGAGGGCGCGGCCTCGACGGGCTTCGAAGGTATCGCGCCCCGGAAGCAGACGGTGGCGACGCCCAATCCC
ATGGCCACGCCCCTGAGGGCCGGCGGGGTGGGAGCCACTCCGGGCCGGCAGACGCCGCTTCGGACGCCACGCGAC
ACGTTCTCTCTGAACCGGGGCGACGGCGATGCGACTCCCTCGGCATCGGCCACACCCCGAGACCTGCGACGACGC
GAGGCGGCGATGCGGGACCAGCTCCGGACGGGTCTCGCGTCGTTGCCGAAGCCCAAAGACAGCGAATGGGAGTTT
GAGCTGCCCGACGGCCAGCAAGAGCCCAGCGGATTGTCGGACCAACAGCGGCAAGAGGACGCAGCCGAGCGCGAC
AGACGAGAGCGCCATCGGCGAGCGGCAGAGGAGGAGTTGGCCCTGCGGCGAAGGACTCAGGTGATGCAGCGGGCA
CTTCCCAGGCCACTCTCGGTCCATTTCGCGCAGCTGGCGAGGGCTGCTGAAGAGACTACGGACTCGGCTCGGGCT
CTCATCGCCAGGGAGGTGGCCGTGCTCGTGGCTGACGACGCGTCCAAGTATCCGCTTCCCGGGTCACGACTCAGC
GGCGGTCCGGCCCCGGCTCCGGAGCAGATGGACGACGGAGCGCTGGCCGATGCTCGTCTCGCCATTCTCTCCGAG
ACCAAGCCCCGACCCGGACTCGACGCGGTGCAGTCTCTCTTCCAGTCTCGCGCTCGGGACTCGACGCTCCTCGGC
CTCGGCTGCTACGACGACGACGACGACGACGACGACGACGACGATGATGAGCAACGGCAAGAAGCAGCCATGCGC
TCCGCCTTTGACGCTGTACAAGACTCCATCATGGCGTCGGCCGAGACGGGCGCCAAGCTGGAGAAGAAGCTGGCC
CTCCACCTCGGCGGCTACCAGAAACGTCAGCGTCTTCTCCGCGACAGCATGATGGAAAAGGCCGACGCACTGTCC
CGCGCCCGCAACGCGCTGGCCGGCTACCGGGTTCTGGCGGCCGCAGAGGAGGTGGCGCTGGAGGCAAGGCTCGAG
AAGCGGCGGGCCGACGTGGCGTTTGTGGCGGGTAGGATGAGGGCTGCTCAGGAGAGGCATCGGAGGGCGAGTGAA
GAGCTCGATGAGTTGATGGATGTGAATGGTTTCTGA
Gene >Ophcf2|04133
ATGCCGGTGGTCAAGGGAGGCGTCTGGACCAACATCGAGGACGAGATCCTCAAGGCCTCGGTCTCCAAATATGGA
CTCAACCAGTGGGCCCGCGTCTCCTCGTTGCTGGCGCGGAAGACGCCCAAGCAGTGCAAAGCCCGATGGAACGAA
TGGCTCGATCCCAGCATCAAGAAGATCGAGTGGAGCAAGGAAGAGGACGAGAAGCTGCTGCATCTAGCCAAGATC
ATGCCCACTCAGTGGCGCACCATCGCCCCCATCGTCGGCCGCACCGCCAATCAGTGCCTCGAGCGCTATCAGAAG
CTGCTTGACGAGGCAGAGGCTCACGAGTCTTCGTCCCTCGACCTCGCCGGTCCCCAAGGTCCCGAGACTCAGGCT
CCCAGCGCCCAGGACTTGAGGCGGTTGCGCCCGGGAGAGCTCGACCCGGATCCGGAGACGAAGCCGGCTCGACCC
GATACCATCGACCTCGATGAGGATGAAAAGGAGATGCTTAGCGAGGCACGCGCCCGTCTCGCCAACACACAGGGT
AAAAAGGCCAAGCGCAAGGCCCGCGAGCGTCAGCAGGAGGAGTCACGCCGTCTGGCTTCTCTGCAGAAGCGGAGG
GAGCTCAAGACGGCCGGCATCAACATCAAGATTACCAACCGCAAGAAGGGCGAGATGGACTACAATGCAGACATC
CCCTTTGAGAAGCCAGCCGCGCCGGGCTTCTACGACACGACGGAAGAGCAGGCCCGCAATGATCTGCAACGTCTG
GCCGTCGATCCCCGCAAGCAACACCTCGCCACCAAGCGCAAGGGTGACGACGACAGTGATGGCGACCGCAAGAGG
CGCAGGAACGACAAGGAAGGTCTTTCGGACTCGCAAAAGGCGGCACTCCGAGCCGGGCAGATGCAGAAGCTGCGC
GAGGCCGAGCAGAACAGCAAGCGACGGGCGCTCAACCTCCCGGCTCCGCAGGTCAGCGACGGCGAGCTCGAGGAG
ATTATCAAGATGGGCAAGATGGGCGAGGCGGCCAGCAACATGGCCAGGGAGAGCGACAATGAGGCGACAAAGGGC
TTCATCAACCCGTACTCGGCGCTCAACGCCAACGCGCCCATCCGGACACCCAAGGCGCCAGCGCAGGAGGATCAC
ATCGCCAACGAGATTCGCAATATTCGTGCGCTCAACGAGACTCAATCGGCGCTGCTCGGTGGCGAGAACACGCCG
CTACACGAGGGCGCGGCCTCGACGGGCTTCGAAGGTATCGCGCCCCGGAAGCAGACGGTGGCGACGCCCAATCCC
ATGGCCACGCCCCTGAGGGCCGGCGGGGTGGGAGCCACTCCGGGCCGGCAGACGCCGCTTCGGACGCCACGCGAC
ACGTTCTCTCTGAACCGGGGCGACGGCGATGCGACTCCCTCGGCATCGGCCACACCCCGAGACCTGCGACGACGC
GAGGCGGCGATGCGGGACCAGCTCCGGACGGGTCTCGCGTCGTTGCCGAAGCCCAAAGACAGCGAATGGGAGTTT
GAGCTGCCCGACGGCCAGCAAGAGCCCAGCGGATTGTCGGACCAACAGCGGCAAGAGGACGCAGCCGAGCGCGAC
AGACGAGAGCGCCATCGGCGAGCGGCAGAGGAGGAGTTGGCCCTGCGGCGAAGGACTCAGGTGATGCAGCGGGCA
CTTCCCAGGCCACTCTCGGTCCATTTCGCGCAGCTGGCGAGGGCTGCTGAAGAGACTACGGACTCGGCTCGGGCT
CTCATCGCCAGGGAGGTGGCCGTGCTCGTGGCTGACGACGCGTCCAAGTATCCGCTTCCCGGGTCACGACTCAGC
GGCGGTCCGGCCCCGGCTCCGGAGCAGATGGACGACGGAGCGCTGGCCGATGCTCGTCTCGCCATTCTCTCCGAG
ACCAAGCCCCGACCCGGACTCGACGCGGTGCAGTCTCTCTTCCAGTCTCGCGCTCGGGACTCGACGCTCCTCGGC
CTCGGCTGCTACGACGACGACGACGACGACGACGACGACGACGATGATGAGCAACGGCAAGAAGCAGCCATGCGC
TCCGCCTTTGACGTACGTATTACCATACCCTCTTCCTCTCCCCTCTTTTCATTCTCTTCTGACCATCCCAGGCTG
TACAAGACTCCATCATGGCGTCGGCCGAGACGGGCGCCAAGCTGGAGAAGAAGCTGGCCCTCCACCTCGGCGGCT
ACCAGAAACGTCAGCGTCTTCTCCGCGACAGCATGATGGAAAAGGCCGACGCACTGTCCCGCGCCCGCAACGCGC
TGGCCGGCTACCGGGTTCTGGCGGCCGCAGAGGAGGTGGCGCTGGAGGCAAGGCTCGAGAAGCGGCGGGCCGACG
TGGCGTTTGTGGCGGGTAGGATGAGGGCTGCTCAGGAGAGGCATCGGAGGGCGAGTGAAGAGCTCGATGAGTTGA
TGGATGTGAATGGTTTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail