Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04131
Gene name
Locationscaffold_04:928949..929846
Strand-
Gene length (bp)897
Transcript length (bp)747
Coding sequence length (bp)747
Protein length (aa) 249

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03227 GILT Gamma interferon inducible lysosomal thiol reductase (GILT) 9.9E-19 67 164

GO

GO Term Description Terminal node
GO:0016671 oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.5

Transmembrane Domains

Domain # Start End Length
1 21 40 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04131
MDEKTVITSRRQSAMNPRARPIMRILIFSVFVIVVFFASLSRRPPAWTRRFGSQTPPVTTSKLVPLEAHIISKCP
DTRDALRELILPVMQQVSDKVDFKLNYIGTPVGDDGIKCKHGPDECMGNIVELCARELYSDPKTNLGFIYCLTKK
YPDIPKQALVEDCALEHQVDVRLLNECATRDDGAYGLNLLRESVKRSAEANATISCTVRLNNQVYCIHDGGKWIQ
CPQGPAVSDLVSAIKKLHGPSSS*
Coding >Ophcf2|04131
ATGGACGAAAAGACAGTCATCACCTCTCGTCGACAGTCCGCCATGAATCCCCGTGCCCGCCCCATCATGCGCATC
CTCATATTCTCCGTCTTCGTCATCGTCGTCTTCTTCGCCAGTCTATCCCGCCGTCCACCGGCCTGGACTCGTCGC
TTCGGCTCCCAAACCCCCCCCGTCACGACTTCCAAGCTGGTCCCGCTCGAGGCACACATCATCAGCAAATGCCCA
GACACTAGGGATGCCCTGCGAGAGCTCATCCTGCCCGTCATGCAGCAGGTCTCGGACAAGGTTGACTTTAAACTC
AACTACATCGGGACTCCCGTCGGCGACGATGGCATCAAATGCAAGCACGGGCCGGACGAATGCATGGGGAACATT
GTCGAGCTCTGCGCACGAGAACTCTACTCCGATCCCAAGACCAACCTCGGCTTCATATATTGTCTGACGAAGAAA
TACCCCGACATCCCCAAGCAAGCCCTCGTCGAAGACTGCGCTCTAGAGCATCAAGTCGACGTCCGGCTTCTCAAC
GAGTGCGCGACTCGTGACGATGGCGCATACGGCCTCAATCTCTTGCGCGAGAGTGTCAAGCGCTCCGCCGAGGCC
AACGCAACCATCAGCTGCACCGTCCGTCTCAACAATCAAGTCTACTGCATCCACGACGGCGGCAAATGGATTCAA
TGTCCCCAAGGCCCCGCCGTATCCGACCTAGTCTCCGCCATCAAGAAGCTCCACGGCCCGTCGTCATCCTAG
Transcript >Ophcf2|04131
ATGGACGAAAAGACAGTCATCACCTCTCGTCGACAGTCCGCCATGAATCCCCGTGCCCGCCCCATCATGCGCATC
CTCATATTCTCCGTCTTCGTCATCGTCGTCTTCTTCGCCAGTCTATCCCGCCGTCCACCGGCCTGGACTCGTCGC
TTCGGCTCCCAAACCCCCCCCGTCACGACTTCCAAGCTGGTCCCGCTCGAGGCACACATCATCAGCAAATGCCCA
GACACTAGGGATGCCCTGCGAGAGCTCATCCTGCCCGTCATGCAGCAGGTCTCGGACAAGGTTGACTTTAAACTC
AACTACATCGGGACTCCCGTCGGCGACGATGGCATCAAATGCAAGCACGGGCCGGACGAATGCATGGGGAACATT
GTCGAGCTCTGCGCACGAGAACTCTACTCCGATCCCAAGACCAACCTCGGCTTCATATATTGTCTGACGAAGAAA
TACCCCGACATCCCCAAGCAAGCCCTCGTCGAAGACTGCGCTCTAGAGCATCAAGTCGACGTCCGGCTTCTCAAC
GAGTGCGCGACTCGTGACGATGGCGCATACGGCCTCAATCTCTTGCGCGAGAGTGTCAAGCGCTCCGCCGAGGCC
AACGCAACCATCAGCTGCACCGTCCGTCTCAACAATCAAGTCTACTGCATCCACGACGGCGGCAAATGGATTCAA
TGTCCCCAAGGCCCCGCCGTATCCGACCTAGTCTCCGCCATCAAGAAGCTCCACGGCCCGTCGTCATCCTAG
Gene >Ophcf2|04131
ATGGACGAAAAGACAGTCATCACCTCTCGTCGACAGTCCGCCATGAATCCCCGTGCCCGCCCCATCATGCGCATC
CTCATATTCTCCGTCTTCGTCATCGTCGTCTTCTTCGCCAGTCTATCCCGCCGTCCACCGGCCTGGACTCGTCGC
TTCGGCTCCCAAACCCCCCCCGTCACGACTTCCAAGCTGGTCCCGCTCGAGGCACACATCATCAGCAAATGCCCA
GACACTAGGGTCCGTACAAGATGTCCGATACGCCTCCCCGCGCTGACCGCTTCCAGGATGCCCTGCGAGAGCTCA
TCCTGCCCGTCATGCAGCAGGTCTCGGACAAGGTTGACTTTAAACTCAACTACATCGGGACGTGAGGCTCGACCT
CTTTTGGACACACCGGAGGCTTCACGCTGACTTTATGCCGCAGTCCCGTCGGCGACGATGGCATCAAATGCAAGC
ACGGGCCGGACGAATGCATGGGGAACATTGTCGAGCTCTGCGCACGAGAACTCTACTCCGATCCCAAGACCAACC
TCGGCTTCATATATTGTCTGACGAAGAAATACCCCGACATCCCCAAGCAAGCCCTCGTCGAAGACTGCGCTCTAG
AGCATCAAGTCGACGTCCGGCTTCTCAACGAGTGCGCGACTCGTGACGATGGCGCATACGGCCTCAATCTCTTGC
GCGAGAGTGTCAAGCGCTCCGCCGAGGTGAGCTCCGAGGGCAAAACCACCCGGACGAAGCTGACAATCATAGGCC
AACGCAACCATCAGCTGCACCGTCCGTCTCAACAATCAAGTCTACTGCATCCACGACGGCGGCAAATGGATTCAA
TGTCCCCAAGGCCCCGCCGTATCCGACCTAGTCTCCGCCATCAAGAAGCTCCACGGCCCGTCGTCATCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail