Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04130
Gene name
Locationscaffold_04:927902..928869
Strand+
Gene length (bp)967
Transcript length (bp)696
Coding sequence length (bp)696
Protein length (aa) 232

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11969 DcpS_C Scavenger mRNA decapping enzyme C-term binding 5.5E-28 105 224
PF05652 DcpS Scavenger mRNA decapping enzyme (DcpS) N-terminal 1.4E-08 6 46

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0000290 deadenylation-dependent decapping of nuclear-transcribed mRNA Yes
GO:0044265 cellular macromolecule catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0003824 catalytic activity No
GO:0110156 methylguanosine-cap decapping No
GO:0043170 macromolecule metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0034655 nucleobase-containing compound catabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008152 metabolic process No
GO:0010605 negative regulation of macromolecule metabolic process No
GO:0009056 catabolic process No
GO:0050789 regulation of biological process No
GO:0009987 cellular process No
GO:0048519 negative regulation of biological process No
GO:0006401 RNA catabolic process No
GO:0044237 cellular metabolic process No
GO:1901361 organic cyclic compound catabolic process No
GO:0019439 aromatic compound catabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044270 cellular nitrogen compound catabolic process No
GO:0008150 biological_process No
GO:0000956 nuclear-transcribed mRNA catabolic process No
GO:0010468 regulation of gene expression No
GO:0060255 regulation of macromolecule metabolic process No
GO:1901575 organic substance catabolic process No
GO:0016071 mRNA metabolic process No
GO:0065007 biological regulation No
GO:0071704 organic substance metabolic process No
GO:0019222 regulation of metabolic process No
GO:0006402 mRNA catabolic process No
GO:0010629 negative regulation of gene expression No
GO:0110154 RNA decapping No
GO:0009892 negative regulation of metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0044248 cellular catabolic process No
GO:0009057 macromolecule catabolic process No
GO:0046700 heterocycle catabolic process No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.4902 0.6641 0.3306 0.0917 0.1877 0.1545 0.0185 0.0813 0.0692 0.0947

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 201.74 115.91 287.57
Alive In ants, during behavior modification 400.21 210.03 590.39
Dead In ants, recently dead 326.05 180.80 471.30

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.255035 no
Dead Fungus 0.007612 yes

Orthologs

Orthofinder run ID4
Orthogroup5460
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5414
Ophiocordyceps australis map64 (Brazil) OphauB2|3875
Ophiocordyceps camponoti-floridani Ophcf2|04130 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|912
Ophiocordyceps kimflemingae Ophio5|7030
Ophiocordyceps subramaniannii Hirsu2|6234

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04130
MASAATRFKLTSVLNQDQSGRRVSLAGEVDGSDAVLVVERAPFSDEGSGWRDWRRGWGGLITPCTKSHVDKYTKQ
PIRSVTETPELYRKVIRPLMQRAREGGRLNWVYNILDGRSEVKDVIYRTPPYHDKDKAFVLLPDLNWDRATVEAL
HLLALVERRDLWSLRDLRKGHVAWLEDMRASLVAATVSKYPALEAHQLKLYLHYQPTYYHLHIHIVHVALEAGAS
QAGHGR*
Coding >Ophcf2|04130
ATGGCCTCCGCAGCAACCCGCTTCAAACTGACCAGCGTCCTTAACCAAGACCAATCGGGTCGACGCGTCAGTCTC
GCGGGAGAGGTGGACGGCTCGGATGCCGTCCTTGTCGTCGAGAGGGCTCCTTTTTCGGACGAGGGGAGTGGCTGG
CGGGATTGGCGGCGAGGATGGGGGGGTCTCATCACTCCCTGCACGAAATCCCACGTGGACAAATACACCAAGCAG
CCCATCCGATCCGTCACCGAAACGCCAGAGCTCTACCGAAAAGTCATCCGCCCGCTCATGCAACGCGCTCGAGAA
GGAGGACGTCTGAACTGGGTGTACAACATTCTCGATGGCCGCTCCGAAGTAAAGGACGTTATATACAGGACCCCT
CCCTACCATGACAAGGATAAAGCCTTCGTTCTTCTGCCTGATCTGAACTGGGATCGTGCTACCGTCGAGGCGCTG
CATTTACTGGCGCTGGTTGAGAGGCGGGATCTTTGGTCTTTGAGGGATCTTCGGAAGGGGCACGTTGCTTGGTTG
GAAGATATGCGCGCGAGTCTCGTGGCTGCAACCGTTTCCAAATACCCGGCTCTCGAGGCGCATCAACTGAAGCTG
TACCTTCATTACCAGCCGACGTACTACCACCTACACATCCACATCGTCCACGTCGCCCTCGAGGCCGGCGCCAGT
CAGGCCGGTCATGGGCGGTGA
Transcript >Ophcf2|04130
ATGGCCTCCGCAGCAACCCGCTTCAAACTGACCAGCGTCCTTAACCAAGACCAATCGGGTCGACGCGTCAGTCTC
GCGGGAGAGGTGGACGGCTCGGATGCCGTCCTTGTCGTCGAGAGGGCTCCTTTTTCGGACGAGGGGAGTGGCTGG
CGGGATTGGCGGCGAGGATGGGGGGGTCTCATCACTCCCTGCACGAAATCCCACGTGGACAAATACACCAAGCAG
CCCATCCGATCCGTCACCGAAACGCCAGAGCTCTACCGAAAAGTCATCCGCCCGCTCATGCAACGCGCTCGAGAA
GGAGGACGTCTGAACTGGGTGTACAACATTCTCGATGGCCGCTCCGAAGTAAAGGACGTTATATACAGGACCCCT
CCCTACCATGACAAGGATAAAGCCTTCGTTCTTCTGCCTGATCTGAACTGGGATCGTGCTACCGTCGAGGCGCTG
CATTTACTGGCGCTGGTTGAGAGGCGGGATCTTTGGTCTTTGAGGGATCTTCGGAAGGGGCACGTTGCTTGGTTG
GAAGATATGCGCGCGAGTCTCGTGGCTGCAACCGTTTCCAAATACCCGGCTCTCGAGGCGCATCAACTGAAGCTG
TACCTTCATTACCAGCCGACGTACTACCACCTACACATCCACATCGTCCACGTCGCCCTCGAGGCCGGCGCCAGT
CAGGCCGGTCATGGGCGGTGA
Gene >Ophcf2|04130
ATGGCCTCCGCAGCAACCCGCTTCAAACTGACCAGCGTCCTTAACCAAGGTATCTACCTACCTCTCTAACTCCCC
CCCCTCACATCCCATCCCACCCTTGCAGAGACATGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGGACGGTGGG
CTAACGAGAGAGGGGGGGATGGTGGGAAAAGACCAATCGGGTCGACGCGTCAGTCTCGCGGGAGAGGTGGACGGC
TCGGATGCCGTCCTTGTCGTCGAGAGGGCTCCTTTTTCGGACGAGGGGAGTGGCTGGCGGGATTGGCGGCGAGGA
TGGGGGGGGTGAGGGAGTTGGGGGCTAATGATGTTTACAGCTGGGGGGTCGCGAGACTTGACGGTGGGGAGGGCG
AGGGTGAGCCTCCGGATGTCAAAATCAGTCTCATCACTCCCTGCACGAAATCCCACGTGGACAAATACACCAAGC
AGCCCATCCGATCCGTCACCGAAACGCCAGAGCTCTACCGAAAAGTCATCCGCCCGCTCATGCAACGCGCTCGAG
AAGGAGGACGTCTGAACTGGGTGTACAACATTCTCGATGGCCGCTCCGAAGTAAAGGACGTTATATACAGGACCC
CTCCCTACCATGACAAGGATAAAGCCTTCGTTCTTCTGCCTGATCTGAACTGGGATCGTGCTACCGTCGAGGCGC
TGCATTTACTGGCGCTGGTTGAGAGGCGGGATCTTTGGTCTTTGAGGGATCTTCGGAAGGGGCACGTTGCTTGGT
TGGAAGATATGCGCGCGAGTCTCGTGGCTGCAACCGTTTCCAAATACCCGGCTCTCGAGGCGCATCAACTGAAGC
TGTACCTTCATTACCAGCCGACGTACTACCACCTACACATCCACATCGTCCACGTCGCCCTCGAGGCCGGCGCCA
GTCAGGCCGTGGGTAAGGCTATGGGGTTGGACGCCATCATCGAGACGCTCAGGGTCATGGGCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail