Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04125
Gene name
Locationscaffold_04:914698..917056
Strand+
Gene length (bp)2358
Transcript length (bp)2358
Coding sequence length (bp)2358
Protein length (aa) 786

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08608 Wyosine_form Wyosine base formation 9.5E-24 634 702
PF04055 Radical_SAM Radical SAM superfamily 6.0E-23 449 626

GO

GO Term Description Terminal node
GO:0051536 iron-sulfur cluster binding Yes
GO:0003824 catalytic activity Yes
GO:0051540 metal cluster binding No
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide 0.1708 0.3829 0.0527 0.1047 0.3556 0.0265 0.7391 0.1401 0.4078 0.1475

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4420
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5422
Ophiocordyceps australis map64 (Brazil) OphauB2|3883
Ophiocordyceps camponoti-floridani Ophcf2|04125 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4034
Ophiocordyceps kimflemingae Ophio5|7035
Ophiocordyceps subramaniannii Hirsu2|9150

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04125
MEVPGWLPLYGAIDGPRLALADVIDLWHAYRTSLILCVVAILFAFRLFLRSHEEETLLALPSVYRHGEHAPVEKT
SSGPRRIKGRAVKKAKRPVDDAASTIPPVKLIVFYSSVTDTTAKLARVYHHGLFSVVERLARETGRSFLKPELLD
LAEMDLDDFFVAPPTTPAEAGLFYLFLFPSYNIDSINDTVLQHLRETHHDFRIDTAPLASLLGYSIFGYGDREGW
PDEERGFCFQAIELDKCMSKLTGRKRAYPVGMGDVKGDHEERFAEWAAGVEDVVANVARTGHLGLGVRGSGDAVE
SDDEEVDGGDGGGGGGEDASDQRRERPLDDVEDLGKLLRTSGANSGANSGANSGANSGANSGANSGAKPPLAVDF
TTYSQQQTPAVVKEMVPRDSPTYAALTKQGYTIVGSHSGVKICRWTKSALRGRGSCYKYSLYGINSHQCMETTPS
LSCSNKCVFCWRHGTNPVGTTWRWVVDAPDVIFRGVKEGHYSKIRMMRGVPGVRAERYAEALRIRHCALSLVGEP
IFYPYINEFLALLHAEGISSFLVCNAQHPDQLAALKAVTQLYVSIDASNRESLRKIDRPLHRDFWERFLRCLDIL
REKRFRHRTVFRLTLVKGFNVADEVEGYARLVERGLPCFIEVKGVTYCGTSTSANAGISMSNVPFYWEVCDFVRA
LDARLADMGLAYGIAAEHAHSCCVLLASERFRVDGLWRTHIDYRRFFQLLGQRGADGDWSPEDYMGDPTPEWALW
GNGGFDPRDTRVDRKGRSMDVTVVRHRPPEMEHMS*
Coding >Ophcf2|04125
ATGGAGGTCCCAGGCTGGCTCCCGCTATATGGAGCGATCGACGGTCCTCGTCTCGCGCTGGCAGACGTCATCGAC
CTCTGGCACGCCTACCGAACCTCTCTTATCCTCTGCGTCGTCGCCATCCTCTTTGCTTTCCGGCTATTTCTGCGC
AGCCACGAAGAAGAGACGCTCCTTGCGCTTCCCAGCGTCTATCGTCATGGCGAACATGCGCCAGTCGAAAAGACG
AGCAGTGGTCCGCGTCGGATCAAGGGCCGCGCCGTCAAGAAAGCGAAACGACCGGTCGATGACGCCGCGTCTACG
ATACCACCCGTCAAACTCATCGTCTTCTACTCGTCCGTGACGGATACTACGGCGAAGCTGGCTCGTGTCTATCAC
CATGGTTTGTTCTCGGTTGTGGAGAGGCTGGCGCGAGAAACGGGACGGTCGTTTCTGAAGCCTGAGCTGCTTGAT
CTGGCGGAGATGGATCTCGACGACTTCTTCGTTGCGCCGCCGACGACTCCGGCCGAGGCGGGCCTTTTCTATCTC
TTTCTTTTCCCGAGTTATAATATCGATAGCATCAATGATACGGTTCTGCAGCATCTGCGCGAGACGCATCACGAC
TTTCGCATCGATACGGCGCCTCTCGCCTCGTTGCTGGGGTACTCGATCTTCGGCTACGGGGATAGGGAGGGCTGG
CCGGATGAGGAGCGGGGGTTCTGCTTCCAGGCTATCGAGCTGGACAAGTGTATGTCCAAGCTTACGGGCCGCAAG
CGCGCGTACCCTGTTGGCATGGGCGACGTCAAGGGGGATCATGAAGAGAGATTCGCTGAGTGGGCTGCTGGTGTC
GAGGATGTGGTCGCCAATGTCGCTCGGACGGGACACCTTGGTCTGGGCGTTCGTGGGAGTGGCGATGCTGTCGAG
AGTGATGACGAGGAGGTTGATGGTGGTGATGGTGGTGGTGGTGGCGGTGAAGATGCGTCTGACCAACGACGGGAG
CGGCCGCTGGACGATGTTGAGGATCTGGGCAAGTTGCTTCGCACGTCGGGGGCCAACTCAGGGGCCAACTCAGGG
GCCAACTCAGGGGCCAACTCAGGGGCCAACTCAGGGGCCAACTCAGGGGCCAAGCCACCCCTGGCCGTCGACTTC
ACCACATACAGCCAACAGCAGACTCCAGCCGTCGTCAAGGAAATGGTCCCTCGCGACTCACCCACATACGCGGCC
CTCACCAAGCAGGGTTACACCATCGTCGGCTCTCACTCAGGCGTCAAGATCTGCCGCTGGACCAAGTCAGCCCTC
CGAGGCCGTGGCAGCTGCTACAAGTACTCCCTCTACGGCATCAACTCGCACCAATGCATGGAGACGACTCCCTCG
CTATCGTGCTCCAACAAGTGCGTCTTCTGCTGGCGCCACGGCACCAACCCCGTCGGAACAACCTGGCGCTGGGTC
GTGGACGCGCCCGACGTCATCTTCCGCGGCGTCAAGGAGGGTCATTATAGCAAGATCCGCATGATGCGCGGCGTT
CCAGGCGTGAGGGCTGAGAGATACGCCGAAGCGCTTCGGATTCGTCACTGCGCGCTCTCGCTCGTCGGAGAGCCC
ATCTTTTACCCTTACATCAATGAGTTTCTCGCCTTGCTCCACGCAGAGGGCATCTCGTCTTTTCTCGTCTGTAAC
GCTCAGCATCCGGATCAGCTGGCGGCTTTGAAAGCAGTGACGCAGCTTTACGTTTCCATCGACGCCTCTAACCGC
GAGTCACTACGCAAGATAGATCGTCCTCTTCACCGCGACTTCTGGGAACGCTTCCTACGCTGCCTCGACATCCTC
CGCGAGAAACGCTTCCGCCACCGAACCGTCTTTCGCCTCACCCTCGTCAAGGGCTTCAACGTCGCCGACGAAGTC
GAAGGATACGCCCGCCTCGTCGAGCGTGGCCTCCCCTGCTTCATAGAAGTCAAGGGCGTGACCTACTGCGGCACC
TCTACATCCGCCAACGCCGGCATCTCAATGTCCAACGTTCCCTTTTACTGGGAGGTTTGCGACTTTGTCCGCGCG
CTCGACGCCCGGCTCGCCGACATGGGCTTGGCTTACGGTATCGCGGCTGAGCATGCGCATAGCTGCTGCGTTCTT
CTGGCTAGCGAGCGGTTTCGCGTCGACGGTCTTTGGCGCACTCATATCGATTATAGACGATTCTTCCAACTTCTC
GGCCAGAGGGGCGCTGACGGTGACTGGTCGCCTGAGGATTACATGGGCGATCCGACGCCTGAGTGGGCGCTTTGG
GGGAATGGCGGCTTTGATCCCCGTGATACTAGGGTTGATCGGAAGGGGAGGAGTATGGATGTGACCGTCGTTCGG
CATCGGCCGCCGGAGATGGAGCACATGTCGTAA
Transcript >Ophcf2|04125
ATGGAGGTCCCAGGCTGGCTCCCGCTATATGGAGCGATCGACGGTCCTCGTCTCGCGCTGGCAGACGTCATCGAC
CTCTGGCACGCCTACCGAACCTCTCTTATCCTCTGCGTCGTCGCCATCCTCTTTGCTTTCCGGCTATTTCTGCGC
AGCCACGAAGAAGAGACGCTCCTTGCGCTTCCCAGCGTCTATCGTCATGGCGAACATGCGCCAGTCGAAAAGACG
AGCAGTGGTCCGCGTCGGATCAAGGGCCGCGCCGTCAAGAAAGCGAAACGACCGGTCGATGACGCCGCGTCTACG
ATACCACCCGTCAAACTCATCGTCTTCTACTCGTCCGTGACGGATACTACGGCGAAGCTGGCTCGTGTCTATCAC
CATGGTTTGTTCTCGGTTGTGGAGAGGCTGGCGCGAGAAACGGGACGGTCGTTTCTGAAGCCTGAGCTGCTTGAT
CTGGCGGAGATGGATCTCGACGACTTCTTCGTTGCGCCGCCGACGACTCCGGCCGAGGCGGGCCTTTTCTATCTC
TTTCTTTTCCCGAGTTATAATATCGATAGCATCAATGATACGGTTCTGCAGCATCTGCGCGAGACGCATCACGAC
TTTCGCATCGATACGGCGCCTCTCGCCTCGTTGCTGGGGTACTCGATCTTCGGCTACGGGGATAGGGAGGGCTGG
CCGGATGAGGAGCGGGGGTTCTGCTTCCAGGCTATCGAGCTGGACAAGTGTATGTCCAAGCTTACGGGCCGCAAG
CGCGCGTACCCTGTTGGCATGGGCGACGTCAAGGGGGATCATGAAGAGAGATTCGCTGAGTGGGCTGCTGGTGTC
GAGGATGTGGTCGCCAATGTCGCTCGGACGGGACACCTTGGTCTGGGCGTTCGTGGGAGTGGCGATGCTGTCGAG
AGTGATGACGAGGAGGTTGATGGTGGTGATGGTGGTGGTGGTGGCGGTGAAGATGCGTCTGACCAACGACGGGAG
CGGCCGCTGGACGATGTTGAGGATCTGGGCAAGTTGCTTCGCACGTCGGGGGCCAACTCAGGGGCCAACTCAGGG
GCCAACTCAGGGGCCAACTCAGGGGCCAACTCAGGGGCCAACTCAGGGGCCAAGCCACCCCTGGCCGTCGACTTC
ACCACATACAGCCAACAGCAGACTCCAGCCGTCGTCAAGGAAATGGTCCCTCGCGACTCACCCACATACGCGGCC
CTCACCAAGCAGGGTTACACCATCGTCGGCTCTCACTCAGGCGTCAAGATCTGCCGCTGGACCAAGTCAGCCCTC
CGAGGCCGTGGCAGCTGCTACAAGTACTCCCTCTACGGCATCAACTCGCACCAATGCATGGAGACGACTCCCTCG
CTATCGTGCTCCAACAAGTGCGTCTTCTGCTGGCGCCACGGCACCAACCCCGTCGGAACAACCTGGCGCTGGGTC
GTGGACGCGCCCGACGTCATCTTCCGCGGCGTCAAGGAGGGTCATTATAGCAAGATCCGCATGATGCGCGGCGTT
CCAGGCGTGAGGGCTGAGAGATACGCCGAAGCGCTTCGGATTCGTCACTGCGCGCTCTCGCTCGTCGGAGAGCCC
ATCTTTTACCCTTACATCAATGAGTTTCTCGCCTTGCTCCACGCAGAGGGCATCTCGTCTTTTCTCGTCTGTAAC
GCTCAGCATCCGGATCAGCTGGCGGCTTTGAAAGCAGTGACGCAGCTTTACGTTTCCATCGACGCCTCTAACCGC
GAGTCACTACGCAAGATAGATCGTCCTCTTCACCGCGACTTCTGGGAACGCTTCCTACGCTGCCTCGACATCCTC
CGCGAGAAACGCTTCCGCCACCGAACCGTCTTTCGCCTCACCCTCGTCAAGGGCTTCAACGTCGCCGACGAAGTC
GAAGGATACGCCCGCCTCGTCGAGCGTGGCCTCCCCTGCTTCATAGAAGTCAAGGGCGTGACCTACTGCGGCACC
TCTACATCCGCCAACGCCGGCATCTCAATGTCCAACGTTCCCTTTTACTGGGAGGTTTGCGACTTTGTCCGCGCG
CTCGACGCCCGGCTCGCCGACATGGGCTTGGCTTACGGTATCGCGGCTGAGCATGCGCATAGCTGCTGCGTTCTT
CTGGCTAGCGAGCGGTTTCGCGTCGACGGTCTTTGGCGCACTCATATCGATTATAGACGATTCTTCCAACTTCTC
GGCCAGAGGGGCGCTGACGGTGACTGGTCGCCTGAGGATTACATGGGCGATCCGACGCCTGAGTGGGCGCTTTGG
GGGAATGGCGGCTTTGATCCCCGTGATACTAGGGTTGATCGGAAGGGGAGGAGTATGGATGTGACCGTCGTTCGG
CATCGGCCGCCGGAGATGGAGCACATGTCGTAA
Gene >Ophcf2|04125
ATGGAGGTCCCAGGCTGGCTCCCGCTATATGGAGCGATCGACGGTCCTCGTCTCGCGCTGGCAGACGTCATCGAC
CTCTGGCACGCCTACCGAACCTCTCTTATCCTCTGCGTCGTCGCCATCCTCTTTGCTTTCCGGCTATTTCTGCGC
AGCCACGAAGAAGAGACGCTCCTTGCGCTTCCCAGCGTCTATCGTCATGGCGAACATGCGCCAGTCGAAAAGACG
AGCAGTGGTCCGCGTCGGATCAAGGGCCGCGCCGTCAAGAAAGCGAAACGACCGGTCGATGACGCCGCGTCTACG
ATACCACCCGTCAAACTCATCGTCTTCTACTCGTCCGTGACGGATACTACGGCGAAGCTGGCTCGTGTCTATCAC
CATGGTTTGTTCTCGGTTGTGGAGAGGCTGGCGCGAGAAACGGGACGGTCGTTTCTGAAGCCTGAGCTGCTTGAT
CTGGCGGAGATGGATCTCGACGACTTCTTCGTTGCGCCGCCGACGACTCCGGCCGAGGCGGGCCTTTTCTATCTC
TTTCTTTTCCCGAGTTATAATATCGATAGCATCAATGATACGGTTCTGCAGCATCTGCGCGAGACGCATCACGAC
TTTCGCATCGATACGGCGCCTCTCGCCTCGTTGCTGGGGTACTCGATCTTCGGCTACGGGGATAGGGAGGGCTGG
CCGGATGAGGAGCGGGGGTTCTGCTTCCAGGCTATCGAGCTGGACAAGTGTATGTCCAAGCTTACGGGCCGCAAG
CGCGCGTACCCTGTTGGCATGGGCGACGTCAAGGGGGATCATGAAGAGAGATTCGCTGAGTGGGCTGCTGGTGTC
GAGGATGTGGTCGCCAATGTCGCTCGGACGGGACACCTTGGTCTGGGCGTTCGTGGGAGTGGCGATGCTGTCGAG
AGTGATGACGAGGAGGTTGATGGTGGTGATGGTGGTGGTGGTGGCGGTGAAGATGCGTCTGACCAACGACGGGAG
CGGCCGCTGGACGATGTTGAGGATCTGGGCAAGTTGCTTCGCACGTCGGGGGCCAACTCAGGGGCCAACTCAGGG
GCCAACTCAGGGGCCAACTCAGGGGCCAACTCAGGGGCCAACTCAGGGGCCAAGCCACCCCTGGCCGTCGACTTC
ACCACATACAGCCAACAGCAGACTCCAGCCGTCGTCAAGGAAATGGTCCCTCGCGACTCACCCACATACGCGGCC
CTCACCAAGCAGGGTTACACCATCGTCGGCTCTCACTCAGGCGTCAAGATCTGCCGCTGGACCAAGTCAGCCCTC
CGAGGCCGTGGCAGCTGCTACAAGTACTCCCTCTACGGCATCAACTCGCACCAATGCATGGAGACGACTCCCTCG
CTATCGTGCTCCAACAAGTGCGTCTTCTGCTGGCGCCACGGCACCAACCCCGTCGGAACAACCTGGCGCTGGGTC
GTGGACGCGCCCGACGTCATCTTCCGCGGCGTCAAGGAGGGTCATTATAGCAAGATCCGCATGATGCGCGGCGTT
CCAGGCGTGAGGGCTGAGAGATACGCCGAAGCGCTTCGGATTCGTCACTGCGCGCTCTCGCTCGTCGGAGAGCCC
ATCTTTTACCCTTACATCAATGAGTTTCTCGCCTTGCTCCACGCAGAGGGCATCTCGTCTTTTCTCGTCTGTAAC
GCTCAGCATCCGGATCAGCTGGCGGCTTTGAAAGCAGTGACGCAGCTTTACGTTTCCATCGACGCCTCTAACCGC
GAGTCACTACGCAAGATAGATCGTCCTCTTCACCGCGACTTCTGGGAACGCTTCCTACGCTGCCTCGACATCCTC
CGCGAGAAACGCTTCCGCCACCGAACCGTCTTTCGCCTCACCCTCGTCAAGGGCTTCAACGTCGCCGACGAAGTC
GAAGGATACGCCCGCCTCGTCGAGCGTGGCCTCCCCTGCTTCATAGAAGTCAAGGGCGTGACCTACTGCGGCACC
TCTACATCCGCCAACGCCGGCATCTCAATGTCCAACGTTCCCTTTTACTGGGAGGTTTGCGACTTTGTCCGCGCG
CTCGACGCCCGGCTCGCCGACATGGGCTTGGCTTACGGTATCGCGGCTGAGCATGCGCATAGCTGCTGCGTTCTT
CTGGCTAGCGAGCGGTTTCGCGTCGACGGTCTTTGGCGCACTCATATCGATTATAGACGATTCTTCCAACTTCTC
GGCCAGAGGGGCGCTGACGGTGACTGGTCGCCTGAGGATTACATGGGCGATCCGACGCCTGAGTGGGCGCTTTGG
GGGAATGGCGGCTTTGATCCCCGTGATACTAGGGTTGATCGGAAGGGGAGGAGTATGGATGTGACCGTCGTTCGG
CATCGGCCGCCGGAGATGGAGCACATGTCGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail