Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04123
Gene name
Locationscaffold_04:910213..913275
Strand+
Gene length (bp)3062
Transcript length (bp)2604
Coding sequence length (bp)2604
Protein length (aa) 868

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00176 SNF2-rel_dom SNF2-related domain 4.6E-72 266 590
PF08797 HIRAN HIRAN domain 3.4E-15 63 142
PF00271 Helicase_C Helicase conserved C-terminal domain 5.4E-14 700 813
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 3.8E-08 630 673
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 4.5E-08 633 670
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 1.4E-07 633 670
PF13639 zf-RING_2 Ring finger domain 4.4E-07 631 671
PF14634 zf-RING_5 zinc-RING finger domain 1.5E-06 633 671
PF13445 zf-RING_UBOX RING-type zinc-finger 4.9E-06 633 668

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0003676 nucleic acid binding Yes
GO:0140658 ATP-dependent chromatin remodeler activity Yes
GO:0046872 metal ion binding Yes
GO:0008270 zinc ion binding Yes
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides Yes
GO:0046914 transition metal ion binding No
GO:0097159 organic cyclic compound binding No
GO:0140097 catalytic activity, acting on DNA No
GO:0003824 catalytic activity No
GO:1901265 nucleoside phosphate binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0005488 binding No
GO:0043169 cation binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0140657 ATP-dependent activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0030554 adenyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2167 0.8901 0.0688 0.0311 0.058 0.0164 0.0371 0.0193 0.0173 0.0021

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5742
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5423
Ophiocordyceps australis map64 (Brazil) OphauB2|3884
Ophiocordyceps camponoti-floridani Ophcf2|04123 (this protein)
Ophiocordyceps kimflemingae Ophio5|7036
Ophiocordyceps subramaniannii Hirsu2|9151

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04123
MPPARTRKRPAPVAVDLTQDETARTKRPALAAVSDDPTVLAGTQEPDPNELTQEPDEPATEFYGHLDNKIVGVRF
YKGFASAGEAVLCSREPQNQYDSNAIRVDNVLHQQIGHLPRTVVEKIAPFMDSGDIKLEAELTGEKGMFDCPVRL
SFFGPSDPAERERIEKGLKASRLIKATQLKQTKQQAQALRAATGLQSGSTSYGISSDADGVTQAELSLEELIKKS
DATEFRRGGDAIKTLAIDEAYLAAMPMAEQPPQLASTLLPYQLQGLAWMTAKEHPQVPEMGAERPVQLWVKDSSK
GMFWNLASGFVSPNAPKLCSGGILADDMGLGKTLQVISLILTGGSGPTLIVAPVSVMSNWKQQIARHVKPEQAPS
VLVYHGNKKMTAEELIKYDVVIASYGRLAKERDQTQRTLLDKSVRWRRVVLDEGHTIRNARTKVALAACELQAES
RWVLTGTPIVNSVKDLHSLVRFLHLTGGIEVAEIFNNSITRKLTAGEGGGQAILQALVQDICLRRKKDMKFVDLK
LPEKKEFLHRIPFQPAEKVKYDALLSEARGALEEYQARSVSGQRGRFQNVLERLLRLRQTCNHWTLCRKRIDDLM
KLLEEENVVVLNDKNRALLQEALRLYIESQDDCAICYEAPSPPVITNCKHVFCRPCITKAIQIQHKCPMCRNALT
EDCLLEPAPEGTFDDNFDTDTQSSKTEALLQIVRATVQKPGSKVIIFSQWTSFLNIVQNQLVEAGLKFSRIDGSM
NAEKRDRAIEALDHDADTRVMLASLAVCSVGLNLVAADAVILSDSWWAPAIEDQAIDRVHRLGQTRETTIWRLVM
EDSVEERVLTIQAEKRELVGKAFCEKAKKDKVRAADVSRMLA*
Coding >Ophcf2|04123
ATGCCTCCTGCCAGGACCAGGAAGCGCCCCGCCCCCGTCGCCGTCGACCTGACGCAGGATGAGACGGCCCGAACA
AAGCGGCCCGCCCTTGCTGCTGTCTCGGACGATCCAACCGTCCTGGCTGGCACCCAAGAGCCGGACCCTAACGAG
CTGACTCAGGAACCTGATGAGCCGGCGACGGAGTTCTATGGTCATTTGGATAACAAGATTGTTGGTGTCCGGTTT
TATAAAGGATTTGCGTCTGCTGGCGAGGCGGTTCTCTGCAGCAGAGAACCTCAGAACCAGTATGATAGCAATGCT
ATTCGCGTCGACAATGTGCTGCATCAGCAGATTGGACACTTGCCTCGTACCGTAGTCGAGAAGATTGCCCCATTC
ATGGATTCTGGCGATATCAAGTTGGAGGCCGAGTTGACAGGTGAAAAGGGCATGTTCGACTGCCCCGTGCGACTG
TCCTTTTTCGGGCCCAGTGACCCGGCCGAGCGTGAGCGTATCGAAAAGGGTCTCAAAGCCAGCAGGCTCATCAAA
GCAACTCAGCTGAAGCAGACCAAGCAACAGGCCCAGGCTCTCAGAGCGGCCACGGGGCTTCAGTCTGGTTCTACC
TCGTATGGCATCAGCTCTGATGCTGACGGCGTAACTCAGGCGGAGCTCTCGCTCGAAGAACTTATCAAGAAGAGC
GATGCGACTGAGTTTCGCAGGGGCGGTGACGCTATCAAGACACTGGCCATCGATGAGGCCTATTTGGCCGCGATG
CCCATGGCCGAACAGCCTCCGCAGCTGGCGTCGACCCTTTTGCCATATCAGCTTCAGGGTCTGGCATGGATGACC
GCCAAGGAACACCCGCAGGTTCCTGAAATGGGCGCCGAAAGGCCTGTGCAGCTGTGGGTGAAGGACAGCAGCAAA
GGCATGTTTTGGAATCTTGCCTCGGGCTTCGTCAGCCCGAACGCTCCGAAGCTGTGTTCTGGGGGGATCCTCGCC
GACGATATGGGTCTGGGCAAGACGCTCCAGGTCATCAGCCTGATCCTGACGGGCGGTTCTGGACCGACCCTCATC
GTCGCGCCTGTCAGTGTCATGAGCAACTGGAAGCAGCAGATCGCCCGGCACGTCAAGCCGGAGCAGGCCCCCAGC
GTCTTGGTCTATCATGGGAACAAGAAGATGACGGCCGAAGAGCTCATCAAGTACGATGTCGTCATCGCGAGTTAC
GGACGGCTGGCCAAGGAAAGGGACCAGACCCAGCGAACACTGCTGGACAAGTCGGTTCGGTGGCGACGCGTGGTC
CTGGACGAGGGACATACCATTCGAAATGCCCGTACCAAGGTGGCCTTGGCTGCCTGCGAGCTGCAGGCAGAGTCT
CGCTGGGTTCTCACAGGAACGCCCATAGTCAACTCGGTCAAGGATCTGCATTCTCTAGTTCGATTTCTCCATCTG
ACGGGGGGTATAGAAGTGGCGGAAATCTTCAACAACAGCATCACCCGCAAGCTGACGGCTGGAGAAGGCGGTGGC
CAGGCGATCCTTCAGGCCCTCGTTCAAGACATCTGCCTCCGACGCAAAAAGGACATGAAGTTTGTCGATCTCAAG
CTGCCGGAGAAGAAGGAATTTTTGCACCGCATCCCATTCCAACCCGCCGAGAAAGTGAAATACGACGCTCTTCTA
TCCGAAGCTCGTGGCGCGTTGGAAGAGTATCAGGCGCGATCTGTTTCCGGGCAAAGGGGTCGGTTCCAGAACGTC
CTCGAGCGTCTACTTCGGCTTCGACAGACATGTAATCACTGGACGCTCTGCCGGAAACGAATCGACGACCTGATG
AAGCTGCTCGAAGAGGAAAACGTAGTCGTCTTAAACGACAAGAACAGGGCCTTGCTGCAGGAAGCCCTCCGCCTG
TACATCGAGAGCCAAGACGACTGCGCCATCTGCTACGAGGCCCCGTCGCCGCCGGTCATCACCAACTGCAAGCAC
GTCTTCTGTCGGCCATGCATCACCAAGGCCATCCAGATCCAGCACAAGTGCCCCATGTGCCGCAACGCTCTGACC
GAAGACTGTCTGCTGGAGCCGGCTCCCGAGGGCACGTTTGACGACAACTTTGACACGGACACGCAGAGCTCCAAG
ACAGAAGCCCTACTCCAGATTGTGCGGGCGACGGTGCAAAAGCCCGGATCCAAGGTTATCATTTTCTCGCAATGG
ACGTCTTTCCTCAACATTGTGCAGAATCAGCTGGTGGAGGCGGGACTCAAGTTCAGCCGGATCGACGGAAGCATG
AACGCAGAGAAGCGGGACAGGGCGATTGAGGCGCTGGATCATGACGCAGACACGCGGGTGATGCTCGCCAGCCTG
GCCGTGTGCAGCGTCGGTCTCAACCTGGTGGCAGCTGACGCGGTGATACTCTCTGACAGCTGGTGGGCGCCAGCC
ATTGAGGACCAGGCCATCGATCGGGTGCACCGGCTGGGCCAGACGCGCGAGACAACTATCTGGCGCCTGGTGATG
GAGGACAGCGTGGAGGAGCGGGTGCTGACGATACAGGCGGAGAAGCGCGAGCTGGTGGGCAAAGCGTTCTGCGAG
AAGGCCAAGAAGGACAAGGTACGGGCGGCGGATGTGTCGAGGATGCTGGCTTAG
Transcript >Ophcf2|04123
ATGCCTCCTGCCAGGACCAGGAAGCGCCCCGCCCCCGTCGCCGTCGACCTGACGCAGGATGAGACGGCCCGAACA
AAGCGGCCCGCCCTTGCTGCTGTCTCGGACGATCCAACCGTCCTGGCTGGCACCCAAGAGCCGGACCCTAACGAG
CTGACTCAGGAACCTGATGAGCCGGCGACGGAGTTCTATGGTCATTTGGATAACAAGATTGTTGGTGTCCGGTTT
TATAAAGGATTTGCGTCTGCTGGCGAGGCGGTTCTCTGCAGCAGAGAACCTCAGAACCAGTATGATAGCAATGCT
ATTCGCGTCGACAATGTGCTGCATCAGCAGATTGGACACTTGCCTCGTACCGTAGTCGAGAAGATTGCCCCATTC
ATGGATTCTGGCGATATCAAGTTGGAGGCCGAGTTGACAGGTGAAAAGGGCATGTTCGACTGCCCCGTGCGACTG
TCCTTTTTCGGGCCCAGTGACCCGGCCGAGCGTGAGCGTATCGAAAAGGGTCTCAAAGCCAGCAGGCTCATCAAA
GCAACTCAGCTGAAGCAGACCAAGCAACAGGCCCAGGCTCTCAGAGCGGCCACGGGGCTTCAGTCTGGTTCTACC
TCGTATGGCATCAGCTCTGATGCTGACGGCGTAACTCAGGCGGAGCTCTCGCTCGAAGAACTTATCAAGAAGAGC
GATGCGACTGAGTTTCGCAGGGGCGGTGACGCTATCAAGACACTGGCCATCGATGAGGCCTATTTGGCCGCGATG
CCCATGGCCGAACAGCCTCCGCAGCTGGCGTCGACCCTTTTGCCATATCAGCTTCAGGGTCTGGCATGGATGACC
GCCAAGGAACACCCGCAGGTTCCTGAAATGGGCGCCGAAAGGCCTGTGCAGCTGTGGGTGAAGGACAGCAGCAAA
GGCATGTTTTGGAATCTTGCCTCGGGCTTCGTCAGCCCGAACGCTCCGAAGCTGTGTTCTGGGGGGATCCTCGCC
GACGATATGGGTCTGGGCAAGACGCTCCAGGTCATCAGCCTGATCCTGACGGGCGGTTCTGGACCGACCCTCATC
GTCGCGCCTGTCAGTGTCATGAGCAACTGGAAGCAGCAGATCGCCCGGCACGTCAAGCCGGAGCAGGCCCCCAGC
GTCTTGGTCTATCATGGGAACAAGAAGATGACGGCCGAAGAGCTCATCAAGTACGATGTCGTCATCGCGAGTTAC
GGACGGCTGGCCAAGGAAAGGGACCAGACCCAGCGAACACTGCTGGACAAGTCGGTTCGGTGGCGACGCGTGGTC
CTGGACGAGGGACATACCATTCGAAATGCCCGTACCAAGGTGGCCTTGGCTGCCTGCGAGCTGCAGGCAGAGTCT
CGCTGGGTTCTCACAGGAACGCCCATAGTCAACTCGGTCAAGGATCTGCATTCTCTAGTTCGATTTCTCCATCTG
ACGGGGGGTATAGAAGTGGCGGAAATCTTCAACAACAGCATCACCCGCAAGCTGACGGCTGGAGAAGGCGGTGGC
CAGGCGATCCTTCAGGCCCTCGTTCAAGACATCTGCCTCCGACGCAAAAAGGACATGAAGTTTGTCGATCTCAAG
CTGCCGGAGAAGAAGGAATTTTTGCACCGCATCCCATTCCAACCCGCCGAGAAAGTGAAATACGACGCTCTTCTA
TCCGAAGCTCGTGGCGCGTTGGAAGAGTATCAGGCGCGATCTGTTTCCGGGCAAAGGGGTCGGTTCCAGAACGTC
CTCGAGCGTCTACTTCGGCTTCGACAGACATGTAATCACTGGACGCTCTGCCGGAAACGAATCGACGACCTGATG
AAGCTGCTCGAAGAGGAAAACGTAGTCGTCTTAAACGACAAGAACAGGGCCTTGCTGCAGGAAGCCCTCCGCCTG
TACATCGAGAGCCAAGACGACTGCGCCATCTGCTACGAGGCCCCGTCGCCGCCGGTCATCACCAACTGCAAGCAC
GTCTTCTGTCGGCCATGCATCACCAAGGCCATCCAGATCCAGCACAAGTGCCCCATGTGCCGCAACGCTCTGACC
GAAGACTGTCTGCTGGAGCCGGCTCCCGAGGGCACGTTTGACGACAACTTTGACACGGACACGCAGAGCTCCAAG
ACAGAAGCCCTACTCCAGATTGTGCGGGCGACGGTGCAAAAGCCCGGATCCAAGGTTATCATTTTCTCGCAATGG
ACGTCTTTCCTCAACATTGTGCAGAATCAGCTGGTGGAGGCGGGACTCAAGTTCAGCCGGATCGACGGAAGCATG
AACGCAGAGAAGCGGGACAGGGCGATTGAGGCGCTGGATCATGACGCAGACACGCGGGTGATGCTCGCCAGCCTG
GCCGTGTGCAGCGTCGGTCTCAACCTGGTGGCAGCTGACGCGGTGATACTCTCTGACAGCTGGTGGGCGCCAGCC
ATTGAGGACCAGGCCATCGATCGGGTGCACCGGCTGGGCCAGACGCGCGAGACAACTATCTGGCGCCTGGTGATG
GAGGACAGCGTGGAGGAGCGGGTGCTGACGATACAGGCGGAGAAGCGCGAGCTGGTGGGCAAAGCGTTCTGCGAG
AAGGCCAAGAAGGACAAGGTACGGGCGGCGGATGTGTCGAGGATGCTGGCTTAG
Gene >Ophcf2|04123
ATGCCTCCTGCCAGGACCAGGAAGCGCCCCGCCCCCGTCGCCGTCGACCTGACGCAGGATGAGACGGCCCGAACA
AAGCGGCCCGCCCTTGCTGCTGTCTCGGACGATCCAACCGTCCTGGCTGGCACCCAAGAGCCGGACCCTAACGAG
CTGACTCAGGAACCTGATGAGCCGGCGACGGAGTTCTATGGTCATTTGGGTGCGATTTGCTTCTTGGCTCTGTTT
GATACGTGGTAAGCTGACGGCGGTGTAGATAACAAGATTGTTGGTGTCCGGTTTTATAAAGGATTTGCGTCTGCT
GGCGAGGCGGTTCTCTGCAGCAGAGAACCTCAGAACCAGGCATGTTAAGCCGGAGGATTCATTTTGTGCTCCATT
CTGTGCTCGCGCAGCTGACTGCTTGCAGTATGATAGCAATGCTATTCGCGTCGACAATGTGCTGCATCAGCAGAT
TGGACACTTGCCTCGTACCGTAGTCGAGAAGATTGCCCCATTCATGGTACGAGCTGTTCCTGTGTGTGTGTGTGC
CTGTTTGGAGGTGTCACTGACCCGGAACCCCGTTGCAGGATTCTGGCGATATCAAGTTGGAGGCCGAGTTGACAG
GTGAAAAGGGCATGTTCGACTGCCCCGTGCGACTGTCCTTTTTCGGGCCCAGTGACCCGGCCGAGCGTGAGCGTA
TCGAAAAGGGTCTCAAAGCCAGCAGGCTCATCAAAGCAACTCAGCTGAAGCAGACCAAGCAACAGGCCCAGGCTC
TCAGAGCGGCCACGGGGCTTCAGTCTGGTTCTACCTCGTATGGCATCAGCTCTGATGCTGACGGCGTAACTCAGG
CGGAGCTCTCGCTCGAAGAACTTATCAAGAAGAGCGATGCGACTGAGTTTCGCAGGGGCGGTGACGCTATCAAGA
CACTGGCCATCGATGAGGCCTATTTGGCCGCGATGCCCATGGCCGAACAGCCTCCGCAGCTGGCGTCGACCCTTT
TGCCATATCAGCTTCAGGCGAGATCCCCCAACTATAAAACTTTGAGGACTTGCGCTGACCGTTCTGCAGGGTCTG
GCATGGATGACCGCCAAGGAACACCCGCAGGTTCCTGAAATGGGCGCCGAAAGGCCTGTGCAGCTGTGGGTGAAG
GACAGCAGCAAAGGCATGTTTTGGAATCTTGCCTCGGGCTTCGTCAGCCCGAACGCTCCGAAGCTGTGTTCTGGG
GGGATCCTCGCCGACGATATGGGTCTGGGCAAGACGCTCCAGGTCATCAGCCTGATCCTGACGGGCGGTTCTGGA
CCGACCCTCATCGTCGCGCCTGTCAGTGTCATGAGCAACTGGAAGCAGCAGATCGCCCGGCACGTCAAGCCGGAG
CAGGCCCCCAGCGTCTTGGTCTATCATGGGAACAAGAAGATGACGGCCGAAGAGCTCATCAAGTACGATGTCGTC
ATCGCGAGTTACGGACGGCTGGCCAAGGAAAGGGACCAGACCCAGCGAACACTGCTGGACAAGTCGGTTCGGTGG
CGACGCGTGGTCCTGGACGAGGGACATACCATTCGAAATGCCCGTACCAAGGTGGCCTTGGCTGCCTGCGAGCTG
CAGGCAGAGTCTCGCTGGGTTCTCACAGGAACGCCCATGTCAGTTCTAAGCTTCTTCCGGTTCTGATGCGGCCAA
AACTGCTGACGAGATCTACAGAGTCAACTCGGTCAAGGATCTGCATTCTCTAGTTCGATTTCTCCATCTGACGGG
GGGTATAGAAGTGGCGGAAATCTTCAACAACAGCATCACCCGCAAGCTGACGGCTGGAGAAGGCGGTGGCCAGGC
GATCCTTCAGGCCCTCGTTCAAGACATCTGCCTCCGACGCAAAAAGGACATGAAGTTTGTCGATCTCAAGCTGCC
GGAGAAGAAGGAATTTTTGCACCGCATCCCATTCCAACCCGCCGAGAAAGTGAAATACGACGCTCTTCTGTAAGG
CCCTTTCTTGACTTGCTGGTACGCGTTGGACGGGTGCTGACAGTCTCTTATAGATCCGAAGCTCGTGGCGCGTTG
GAAGAGTATCAGGCGCGATCTGTTTCCGGGCAAAGGGGTCGGTTCCAGAACGTCCTCGAGCGTCTACTTCGGCTT
CGACAGACGTACGTACTCCAAGCTCAACTGTTGAGGGTTGCGACTGACCTGGACAGATGTAATCACTGGACGCTC
TGCCGGAAACGAATCGACGACCTGATGAAGCTGCTCGAAGAGGAAAACGTAGTCGTCTTAAACGACAAGAACAGG
GCCTTGCTGCAGGAAGCCCTCCGCCTGTACATCGAGAGCCAAGACGACTGCGCCATCTGCTACGAGGCCCCGTCG
CCGCCGGTCATCACCAACTGCAAGCACGTCTTCTGTCGGCCATGCATCACCAAGGCCATCCAGATCCAGCACAAG
TGCCCCATGTGCCGCAACGCTCTGACCGAAGACTGTCTGCTGGAGCCGGCTCCCGAGGGCACGTTTGACGACAAC
TTTGACACGGACACGCAGAGCTCCAAGACAGAAGCCCTACTCCAGATTGTGCGGGCGACGGTGCAAAAGCCCGGA
TCCAAGGTTATCATTTTCTCGCAATGGACGTCTTTCCTCAACATTGTGCAGAATCAGCTGGTGGAGGCGGGACTC
AAGTTCAGCCGGATCGACGGAAGCATGAACGCAGAGAAGCGGGACAGGGCGATTGAGGCGCTGGATCATGACGCA
GACACGCGGGTGATGCTCGCCAGCCTGGCCGTGTGCAGCGTCGGTCTCAACCTGGTGGCAGCTGACGCGGTGATA
CTCTCTGACAGCTGTAAGTAGTTGCTCGAACCTGGATGGCCTCGACCGGCTGCTGATGTCTCTGTTCAGGGTGGG
CGCCAGCCATTGAGGACCAGGCCATCGATCGGGTGCACCGGCTGGGCCAGACGCGCGAGACAACTATCTGGCGCC
TGGTGATGGAGGACAGCGTGGAGGAGCGGGTGCTGACGATACAGGCGGAGAAGCGCGAGCTGGTGGGCAAAGCGT
TCTGCGAGAAGGCCAAGAAGGACAAGGTACGGGCGGCGGATGTGTCGAGGATGCTGGCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail