Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04121
Gene name
Locationscaffold_04:905630..907632
Strand+
Gene length (bp)2002
Transcript length (bp)1950
Coding sequence length (bp)1950
Protein length (aa) 650

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08637 NCA2 ATP synthase regulation protein NCA2 3.5E-106 362 644

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 351 373 22
2 524 546 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 17.57 9.01 26.12
Alive In ants, during behavior modification 9.53 4.13 14.93
Dead In ants, recently dead 11.76 5.48 18.05

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.005136 yes
Alive Dead 0.328478 no
Dead Fungus 0.075374 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04121
MSIVSDEVRRLDTYLDRLPVRSATASEDEADEDDEHVYAIVDALSCPRLNELLRILRSLSTTSSSQPLLSAKSVR
SLLLQSGLPEENHDDAADAPKSVYEIELEWLIVTKATIQVYGVILNTLLDSICPLSDDIRYWSDVLSSYTYSSLY
TVQTSPIRLCAWTRDVYLVSKARLEFDVVHSAAAGWGRLYQIVRHSIRERSFTSIQRKVLSPVAYSRAEARRKLV
QLRKLRELSASGLGVLMDEGLQIGHEDDKAEPQELKSIVERSVALMDMVLKEVCDLELSTGVFEDRVFAGVEEDP
ELSVHLEEEEAAPGRPATLARRLLRIMDQTLPEHAAAVQTLVQANGRPSRIVRYWLPAVVGLLSSTTLLRILVKR
RAAMIDWVTNLGATVRDFWLNWVVEPTQKVIRTIRHDETSEIAIMSRDSLRADRQSLERMVVDFAVDKPHFAVDG
LSISDAQIAEIRNKVAEGDVTPVLRAYEKDLKSPLMGAVRGDLVRSLLIQVQKTKVDLEVAMTGIDSLLRSQELV
FGFVGLTPGVLVTIGMFQYLRGLAGGRGGQRRSEAQSRATRLLRNIDRILSEARPTENNVLSYRDHGLLLCEVHE
LRLLACSLLPRRVHMDFLEDLDDLANIKGVQIQAKALERIRWAYVRWLG*
Coding >Ophcf2|04121
ATGTCTATCGTCTCCGACGAGGTCCGTCGCCTGGACACGTATCTTGACCGCCTTCCCGTTCGCTCTGCTACCGCG
TCCGAAGACGAAGCCGACGAAGACGATGAGCACGTCTATGCCATCGTCGACGCCTTGTCCTGTCCGAGGTTGAAC
GAACTTCTGCGTATACTTCGGTCGCTCAGCACCACATCGTCGTCTCAGCCGCTGCTATCTGCCAAGAGTGTGCGG
TCCTTGCTCTTGCAGTCTGGCCTGCCGGAGGAGAACCACGATGACGCCGCTGACGCTCCCAAAAGCGTCTACGAG
ATAGAGCTCGAATGGCTGATTGTCACGAAAGCCACCATCCAGGTCTACGGCGTCATTCTCAACACCCTCCTCGAC
AGCATCTGTCCCCTGAGCGACGACATAAGATACTGGTCTGACGTTCTGAGCTCTTACACTTATAGCAGTCTTTAC
ACTGTTCAGACGTCGCCCATCCGGCTGTGCGCCTGGACTCGGGATGTCTACCTGGTCAGCAAAGCCCGCCTGGAG
TTTGATGTAGTTCATTCAGCGGCCGCCGGATGGGGTCGACTCTACCAAATCGTGCGCCACAGCATCAGGGAGCGC
TCCTTCACCAGCATCCAGCGCAAGGTGCTGTCTCCCGTGGCCTACAGCCGGGCCGAGGCGCGTCGGAAGCTGGTG
CAGCTGCGGAAACTACGCGAACTCAGCGCCAGCGGCCTGGGCGTTCTCATGGACGAGGGCCTCCAGATCGGTCAC
GAGGACGACAAGGCTGAGCCGCAAGAACTTAAGAGCATCGTCGAGCGTAGTGTCGCCCTCATGGACATGGTCCTC
AAGGAAGTCTGCGACTTGGAATTGTCGACAGGCGTCTTCGAGGACAGGGTCTTTGCCGGCGTCGAAGAGGACCCG
GAGCTTTCGGTTCACCTGGAGGAGGAAGAGGCCGCGCCGGGCCGACCTGCTACGCTGGCTCGCCGTCTCTTGCGT
ATCATGGACCAGACGCTGCCGGAGCACGCGGCTGCCGTGCAGACACTCGTGCAGGCCAACGGGAGGCCGTCTCGA
ATCGTCCGCTACTGGCTTCCCGCGGTCGTGGGCCTGCTGTCGTCGACGACGCTGCTGCGCATTCTGGTGAAGCGC
CGAGCCGCCATGATCGACTGGGTGACCAATCTGGGCGCGACGGTGAGGGATTTCTGGCTCAACTGGGTCGTGGAG
CCGACGCAGAAAGTCATCAGAACCATCCGTCACGACGAGACGAGCGAGATCGCCATCATGAGCCGGGACAGTCTC
CGGGCCGACCGGCAGAGCCTGGAGAGGATGGTGGTGGACTTTGCCGTCGACAAGCCGCACTTTGCCGTCGACGGT
CTCAGCATCTCGGACGCGCAGATTGCCGAGATCCGCAACAAGGTGGCCGAGGGCGACGTGACGCCAGTGCTGCGG
GCGTACGAAAAGGACCTCAAGAGCCCGCTCATGGGCGCCGTCCGCGGCGACCTCGTCCGCTCACTGCTGATCCAG
GTGCAGAAGACAAAGGTGGACCTAGAGGTGGCCATGACGGGCATCGACTCCCTCCTCCGAAGCCAGGAGCTGGTC
TTTGGCTTCGTCGGTCTGACGCCAGGCGTGCTCGTCACCATCGGCATGTTCCAGTATCTTCGCGGCCTGGCGGGC
GGTCGCGGCGGCCAACGACGCAGCGAGGCGCAATCCCGGGCCACGCGCCTCCTCCGCAACATCGACCGCATCCTT
TCCGAGGCGCGCCCAACGGAGAACAACGTGCTGTCGTACAGGGATCACGGCCTGCTGCTGTGCGAGGTGCACGAG
CTGCGCCTCTTGGCCTGCTCTCTGCTTCCGCGACGCGTCCACATGGACTTTTTGGAGGACCTGGACGACCTCGCC
AATATCAAGGGGGTGCAGATACAGGCCAAGGCACTGGAACGAATCCGGTGGGCGTATGTGAGGTGGCTGGGCTGA
Transcript >Ophcf2|04121
ATGTCTATCGTCTCCGACGAGGTCCGTCGCCTGGACACGTATCTTGACCGCCTTCCCGTTCGCTCTGCTACCGCG
TCCGAAGACGAAGCCGACGAAGACGATGAGCACGTCTATGCCATCGTCGACGCCTTGTCCTGTCCGAGGTTGAAC
GAACTTCTGCGTATACTTCGGTCGCTCAGCACCACATCGTCGTCTCAGCCGCTGCTATCTGCCAAGAGTGTGCGG
TCCTTGCTCTTGCAGTCTGGCCTGCCGGAGGAGAACCACGATGACGCCGCTGACGCTCCCAAAAGCGTCTACGAG
ATAGAGCTCGAATGGCTGATTGTCACGAAAGCCACCATCCAGGTCTACGGCGTCATTCTCAACACCCTCCTCGAC
AGCATCTGTCCCCTGAGCGACGACATAAGATACTGGTCTGACGTTCTGAGCTCTTACACTTATAGCAGTCTTTAC
ACTGTTCAGACGTCGCCCATCCGGCTGTGCGCCTGGACTCGGGATGTCTACCTGGTCAGCAAAGCCCGCCTGGAG
TTTGATGTAGTTCATTCAGCGGCCGCCGGATGGGGTCGACTCTACCAAATCGTGCGCCACAGCATCAGGGAGCGC
TCCTTCACCAGCATCCAGCGCAAGGTGCTGTCTCCCGTGGCCTACAGCCGGGCCGAGGCGCGTCGGAAGCTGGTG
CAGCTGCGGAAACTACGCGAACTCAGCGCCAGCGGCCTGGGCGTTCTCATGGACGAGGGCCTCCAGATCGGTCAC
GAGGACGACAAGGCTGAGCCGCAAGAACTTAAGAGCATCGTCGAGCGTAGTGTCGCCCTCATGGACATGGTCCTC
AAGGAAGTCTGCGACTTGGAATTGTCGACAGGCGTCTTCGAGGACAGGGTCTTTGCCGGCGTCGAAGAGGACCCG
GAGCTTTCGGTTCACCTGGAGGAGGAAGAGGCCGCGCCGGGCCGACCTGCTACGCTGGCTCGCCGTCTCTTGCGT
ATCATGGACCAGACGCTGCCGGAGCACGCGGCTGCCGTGCAGACACTCGTGCAGGCCAACGGGAGGCCGTCTCGA
ATCGTCCGCTACTGGCTTCCCGCGGTCGTGGGCCTGCTGTCGTCGACGACGCTGCTGCGCATTCTGGTGAAGCGC
CGAGCCGCCATGATCGACTGGGTGACCAATCTGGGCGCGACGGTGAGGGATTTCTGGCTCAACTGGGTCGTGGAG
CCGACGCAGAAAGTCATCAGAACCATCCGTCACGACGAGACGAGCGAGATCGCCATCATGAGCCGGGACAGTCTC
CGGGCCGACCGGCAGAGCCTGGAGAGGATGGTGGTGGACTTTGCCGTCGACAAGCCGCACTTTGCCGTCGACGGT
CTCAGCATCTCGGACGCGCAGATTGCCGAGATCCGCAACAAGGTGGCCGAGGGCGACGTGACGCCAGTGCTGCGG
GCGTACGAAAAGGACCTCAAGAGCCCGCTCATGGGCGCCGTCCGCGGCGACCTCGTCCGCTCACTGCTGATCCAG
GTGCAGAAGACAAAGGTGGACCTAGAGGTGGCCATGACGGGCATCGACTCCCTCCTCCGAAGCCAGGAGCTGGTC
TTTGGCTTCGTCGGTCTGACGCCAGGCGTGCTCGTCACCATCGGCATGTTCCAGTATCTTCGCGGCCTGGCGGGC
GGTCGCGGCGGCCAACGACGCAGCGAGGCGCAATCCCGGGCCACGCGCCTCCTCCGCAACATCGACCGCATCCTT
TCCGAGGCGCGCCCAACGGAGAACAACGTGCTGTCGTACAGGGATCACGGCCTGCTGCTGTGCGAGGTGCACGAG
CTGCGCCTCTTGGCCTGCTCTCTGCTTCCGCGACGCGTCCACATGGACTTTTTGGAGGACCTGGACGACCTCGCC
AATATCAAGGGGGTGCAGATACAGGCCAAGGCACTGGAACGAATCCGGTGGGCGTATGTGAGGTGGCTGGGCTGA
Gene >Ophcf2|04121
ATGTCTATCGTCTCCGAGTGAGTCATCTGTCGTCCGCCGTCGGCGTTCCCGCTGATGCGCCTCTCGCAGCGAGGT
CCGTCGCCTGGACACGTATCTTGACCGCCTTCCCGTTCGCTCTGCTACCGCGTCCGAAGACGAAGCCGACGAAGA
CGATGAGCACGTCTATGCCATCGTCGACGCCTTGTCCTGTCCGAGGTTGAACGAACTTCTGCGTATACTTCGGTC
GCTCAGCACCACATCGTCGTCTCAGCCGCTGCTATCTGCCAAGAGTGTGCGGTCCTTGCTCTTGCAGTCTGGCCT
GCCGGAGGAGAACCACGATGACGCCGCTGACGCTCCCAAAAGCGTCTACGAGATAGAGCTCGAATGGCTGATTGT
CACGAAAGCCACCATCCAGGTCTACGGCGTCATTCTCAACACCCTCCTCGACAGCATCTGTCCCCTGAGCGACGA
CATAAGATACTGGTCTGACGTTCTGAGCTCTTACACTTATAGCAGTCTTTACACTGTTCAGACGTCGCCCATCCG
GCTGTGCGCCTGGACTCGGGATGTCTACCTGGTCAGCAAAGCCCGCCTGGAGTTTGATGTAGTTCATTCAGCGGC
CGCCGGATGGGGTCGACTCTACCAAATCGTGCGCCACAGCATCAGGGAGCGCTCCTTCACCAGCATCCAGCGCAA
GGTGCTGTCTCCCGTGGCCTACAGCCGGGCCGAGGCGCGTCGGAAGCTGGTGCAGCTGCGGAAACTACGCGAACT
CAGCGCCAGCGGCCTGGGCGTTCTCATGGACGAGGGCCTCCAGATCGGTCACGAGGACGACAAGGCTGAGCCGCA
AGAACTTAAGAGCATCGTCGAGCGTAGTGTCGCCCTCATGGACATGGTCCTCAAGGAAGTCTGCGACTTGGAATT
GTCGACAGGCGTCTTCGAGGACAGGGTCTTTGCCGGCGTCGAAGAGGACCCGGAGCTTTCGGTTCACCTGGAGGA
GGAAGAGGCCGCGCCGGGCCGACCTGCTACGCTGGCTCGCCGTCTCTTGCGTATCATGGACCAGACGCTGCCGGA
GCACGCGGCTGCCGTGCAGACACTCGTGCAGGCCAACGGGAGGCCGTCTCGAATCGTCCGCTACTGGCTTCCCGC
GGTCGTGGGCCTGCTGTCGTCGACGACGCTGCTGCGCATTCTGGTGAAGCGCCGAGCCGCCATGATCGACTGGGT
GACCAATCTGGGCGCGACGGTGAGGGATTTCTGGCTCAACTGGGTCGTGGAGCCGACGCAGAAAGTCATCAGAAC
CATCCGTCACGACGAGACGAGCGAGATCGCCATCATGAGCCGGGACAGTCTCCGGGCCGACCGGCAGAGCCTGGA
GAGGATGGTGGTGGACTTTGCCGTCGACAAGCCGCACTTTGCCGTCGACGGTCTCAGCATCTCGGACGCGCAGAT
TGCCGAGATCCGCAACAAGGTGGCCGAGGGCGACGTGACGCCAGTGCTGCGGGCGTACGAAAAGGACCTCAAGAG
CCCGCTCATGGGCGCCGTCCGCGGCGACCTCGTCCGCTCACTGCTGATCCAGGTGCAGAAGACAAAGGTGGACCT
AGAGGTGGCCATGACGGGCATCGACTCCCTCCTCCGAAGCCAGGAGCTGGTCTTTGGCTTCGTCGGTCTGACGCC
AGGCGTGCTCGTCACCATCGGCATGTTCCAGTATCTTCGCGGCCTGGCGGGCGGTCGCGGCGGCCAACGACGCAG
CGAGGCGCAATCCCGGGCCACGCGCCTCCTCCGCAACATCGACCGCATCCTTTCCGAGGCGCGCCCAACGGAGAA
CAACGTGCTGTCGTACAGGGATCACGGCCTGCTGCTGTGCGAGGTGCACGAGCTGCGCCTCTTGGCCTGCTCTCT
GCTTCCGCGACGCGTCCACATGGACTTTTTGGAGGACCTGGACGACCTCGCCAATATCAAGGGGGTGCAGATACA
GGCCAAGGCACTGGAACGAATCCGGTGGGCGTATGTGAGGTGGCTGGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail