Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04115
Gene name
Locationscaffold_04:895903..896482
Strand-
Gene length (bp)579
Transcript length (bp)579
Coding sequence length (bp)579
Protein length (aa) 193

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08265 YL1_C YL1 nuclear protein C-terminal domain 1.1E-14 142 170

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2684 0.8154 0.0136 0.0305 0.0191 0.0008 0.0933 0.0094 0.0324 0.002

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3642
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5431
Ophiocordyceps australis map64 (Brazil) OphauB2|3892
Ophiocordyceps camponoti-floridani Ophcf2|04115 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6666
Ophiocordyceps kimflemingae Ophio5|8413
Ophiocordyceps subramaniannii Hirsu2|7026

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04115
MAASTEAQLAHQQLLERLDIHSIHKNFRNPNWRPNQRRNKNIKAIIGDASRREASALATPQDGSGDATPAAEDGL
STSGTLTPAVSTSGTSAPNLAQASRSLSKLVLEKNLRTAGGVGAMTAPSATYTNIESAPSLAHSRHYCDVTGLPA
PYLDPKTRMRYHNKEVFGLIRTLPQPVAEQYLEARGAHTVLK*
Coding >Ophcf2|04115
ATGGCCGCTTCGACCGAGGCACAGCTCGCCCATCAGCAGCTTCTGGAACGCCTCGATATTCACTCGATTCACAAA
AACTTTCGCAACCCAAATTGGCGGCCTAATCAACGACGAAATAAGAACATCAAGGCCATCATCGGCGACGCCTCT
AGGAGAGAGGCATCTGCCCTGGCCACGCCACAGGATGGCAGCGGCGACGCAACTCCGGCCGCCGAAGATGGCCTG
TCAACCAGCGGCACCTTGACGCCTGCTGTCAGCACCTCGGGTACCAGCGCCCCGAACCTGGCCCAGGCCTCGCGC
AGTCTGTCCAAGCTCGTGCTGGAGAAGAATCTCCGGACGGCGGGTGGTGTCGGCGCCATGACGGCCCCAAGTGCT
ACCTACACCAACATCGAGTCGGCGCCGTCCCTGGCCCATTCAAGGCACTACTGCGACGTCACCGGCCTGCCCGCC
CCCTATCTCGACCCCAAGACGCGGATGCGCTACCACAACAAAGAAGTCTTTGGCCTGATTCGCACCCTACCGCAG
CCGGTTGCAGAGCAGTATCTCGAGGCCCGAGGCGCCCACACGGTCCTCAAGTGA
Transcript >Ophcf2|04115
ATGGCCGCTTCGACCGAGGCACAGCTCGCCCATCAGCAGCTTCTGGAACGCCTCGATATTCACTCGATTCACAAA
AACTTTCGCAACCCAAATTGGCGGCCTAATCAACGACGAAATAAGAACATCAAGGCCATCATCGGCGACGCCTCT
AGGAGAGAGGCATCTGCCCTGGCCACGCCACAGGATGGCAGCGGCGACGCAACTCCGGCCGCCGAAGATGGCCTG
TCAACCAGCGGCACCTTGACGCCTGCTGTCAGCACCTCGGGTACCAGCGCCCCGAACCTGGCCCAGGCCTCGCGC
AGTCTGTCCAAGCTCGTGCTGGAGAAGAATCTCCGGACGGCGGGTGGTGTCGGCGCCATGACGGCCCCAAGTGCT
ACCTACACCAACATCGAGTCGGCGCCGTCCCTGGCCCATTCAAGGCACTACTGCGACGTCACCGGCCTGCCCGCC
CCCTATCTCGACCCCAAGACGCGGATGCGCTACCACAACAAAGAAGTCTTTGGCCTGATTCGCACCCTACCGCAG
CCGGTTGCAGAGCAGTATCTCGAGGCCCGAGGCGCCCACACGGTCCTCAAGTGA
Gene >Ophcf2|04115
ATGGCCGCTTCGACCGAGGCACAGCTCGCCCATCAGCAGCTTCTGGAACGCCTCGATATTCACTCGATTCACAAA
AACTTTCGCAACCCAAATTGGCGGCCTAATCAACGACGAAATAAGAACATCAAGGCCATCATCGGCGACGCCTCT
AGGAGAGAGGCATCTGCCCTGGCCACGCCACAGGATGGCAGCGGCGACGCAACTCCGGCCGCCGAAGATGGCCTG
TCAACCAGCGGCACCTTGACGCCTGCTGTCAGCACCTCGGGTACCAGCGCCCCGAACCTGGCCCAGGCCTCGCGC
AGTCTGTCCAAGCTCGTGCTGGAGAAGAATCTCCGGACGGCGGGTGGTGTCGGCGCCATGACGGCCCCAAGTGCT
ACCTACACCAACATCGAGTCGGCGCCGTCCCTGGCCCATTCAAGGCACTACTGCGACGTCACCGGCCTGCCCGCC
CCCTATCTCGACCCCAAGACGCGGATGCGCTACCACAACAAAGAAGTCTTTGGCCTGATTCGCACCCTACCGCAG
CCGGTTGCAGAGCAGTATCTCGAGGCCCGAGGCGCCCACACGGTCCTCAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail