Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04114
Gene name
Locationscaffold_04:893759..895304
Strand-
Gene length (bp)1545
Transcript length (bp)1434
Coding sequence length (bp)1434
Protein length (aa) 478

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00171 Aldedh Aldehyde dehydrogenase family 3.4E-129 19 473

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7893 0.266 0.1504 0.0299 0.2827 0.0323 0.134 0.2279 0.1147 0.0106

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup670
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5661
Ophiocordyceps australis map64 (Brazil) OphauB2|1306
Ophiocordyceps camponoti-floridani Ophcf2|04114 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6667
Ophiocordyceps kimflemingae Ophio5|8412
Ophiocordyceps subramaniannii Hirsu2|10939

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04114
MALENVVPLVINGKDVTTTTTFPVTNPATNEQIWTMSCADKDHVQEAVRTAHEAFEKWSRSKAAYRRDLFLRAAD
VMVRRRTELTGYMRDEVAFEADFQAFIFDACVDFLRDIAGRLVQAVEGSVPESIIPGMRAMVCKRPYGVILGTGS
WNGALLLGLRSVAYALAAGNTAIFKGSELSPKCHWAIADVFREAGLPDGCLNFILHSPSDAETITDALVAHPLVK
KINFTGSTRVGRLIAANAGKHLKPVLLELGGKASAIVLKDADLENAAVHCVNGAFMNSGQICMSTERILVHQSIA
DKFRNMLVAKTKEKYNSSSSTPTLINPTAASRNRNLISQAVEKGARLLPIFAEKEADTPSGMQAVVLENVNSSMD
IYGTESFGPSVSLFTFESEAEAIKLANDSEYGLTAAVFSEDLRAAFRTADALESGAVHINSMTVHDESSIPHGGV
KNSGFGRFNSSQGLDEFMYYKSVTWME*
Coding >Ophcf2|04114
ATGGCCCTCGAAAACGTCGTTCCCCTCGTCATCAACGGCAAAGATGTGACGACTACAACGACATTCCCCGTAACC
AACCCGGCCACCAACGAGCAGATATGGACCATGTCGTGTGCAGACAAGGACCACGTCCAAGAGGCCGTTCGGACC
GCGCATGAAGCCTTTGAGAAATGGTCACGCTCCAAAGCTGCTTACCGCCGCGACCTGTTCCTTCGCGCTGCCGAT
GTCATGGTTCGACGTCGGACTGAGCTGACGGGCTACATGCGTGATGAGGTAGCGTTCGAAGCCGACTTTCAGGCC
TTTATATTCGATGCCTGTGTGGATTTCCTCCGCGACATTGCTGGGAGGCTCGTCCAGGCCGTCGAAGGCTCAGTT
CCCGAGTCCATCATACCCGGCATGAGGGCCATGGTCTGCAAGAGACCGTACGGCGTCATCCTCGGCACCGGTTCA
TGGAACGGAGCTCTCCTACTGGGTCTACGATCCGTCGCGTACGCCCTCGCAGCCGGCAACACAGCCATCTTCAAG
GGCTCCGAGCTCTCTCCCAAATGTCATTGGGCCATCGCCGACGTCTTCCGCGAGGCCGGCTTGCCAGACGGCTGC
CTGAATTTCATCTTGCACTCGCCCTCAGACGCCGAGACCATCACCGACGCGCTCGTCGCCCATCCGCTGGTCAAG
AAGATCAACTTTACCGGCAGCACCCGCGTCGGCCGGCTCATTGCCGCAAATGCCGGGAAGCATCTGAAGCCGGTT
CTGCTGGAACTTGGTGGAAAGGCGAGCGCCATTGTGCTAAAGGACGCCGACCTCGAGAACGCGGCTGTGCACTGC
GTCAATGGCGCCTTTATGAACTCTGGACAGATTTGCATGTCGACGGAGCGCATCCTCGTGCACCAGTCCATCGCC
GACAAGTTCCGCAACATGCTCGTTGCAAAAACCAAGGAAAAGTACAACTCATCCAGCTCAACGCCCACCCTCATC
AACCCCACAGCAGCATCACGAAACCGCAACCTGATATCGCAGGCCGTCGAAAAGGGTGCCCGTCTCCTCCCCATC
TTTGCGGAAAAGGAGGCCGATACACCAAGCGGGATGCAGGCTGTGGTTCTCGAAAACGTCAACAGCAGCATGGAC
ATCTACGGCACCGAATCCTTCGGCCCGAGCGTCTCCCTCTTCACCTTTGAATCCGAGGCCGAGGCCATCAAGCTA
GCCAACGACAGCGAGTACGGCCTCACGGCGGCCGTCTTCTCGGAGGATCTCAGGGCTGCGTTCCGGACGGCTGAT
GCGCTCGAATCCGGAGCTGTGCACATTAACTCGATGACGGTCCATGACGAGAGCTCTATTCCGCACGGGGGAGTT
AAGAATAGCGGCTTTGGGCGCTTCAACTCTAGTCAGGGGCTGGATGAGTTTATGTACTACAAGTCTGTGACGTGG
ATGGAGTAG
Transcript >Ophcf2|04114
ATGGCCCTCGAAAACGTCGTTCCCCTCGTCATCAACGGCAAAGATGTGACGACTACAACGACATTCCCCGTAACC
AACCCGGCCACCAACGAGCAGATATGGACCATGTCGTGTGCAGACAAGGACCACGTCCAAGAGGCCGTTCGGACC
GCGCATGAAGCCTTTGAGAAATGGTCACGCTCCAAAGCTGCTTACCGCCGCGACCTGTTCCTTCGCGCTGCCGAT
GTCATGGTTCGACGTCGGACTGAGCTGACGGGCTACATGCGTGATGAGGTAGCGTTCGAAGCCGACTTTCAGGCC
TTTATATTCGATGCCTGTGTGGATTTCCTCCGCGACATTGCTGGGAGGCTCGTCCAGGCCGTCGAAGGCTCAGTT
CCCGAGTCCATCATACCCGGCATGAGGGCCATGGTCTGCAAGAGACCGTACGGCGTCATCCTCGGCACCGGTTCA
TGGAACGGAGCTCTCCTACTGGGTCTACGATCCGTCGCGTACGCCCTCGCAGCCGGCAACACAGCCATCTTCAAG
GGCTCCGAGCTCTCTCCCAAATGTCATTGGGCCATCGCCGACGTCTTCCGCGAGGCCGGCTTGCCAGACGGCTGC
CTGAATTTCATCTTGCACTCGCCCTCAGACGCCGAGACCATCACCGACGCGCTCGTCGCCCATCCGCTGGTCAAG
AAGATCAACTTTACCGGCAGCACCCGCGTCGGCCGGCTCATTGCCGCAAATGCCGGGAAGCATCTGAAGCCGGTT
CTGCTGGAACTTGGTGGAAAGGCGAGCGCCATTGTGCTAAAGGACGCCGACCTCGAGAACGCGGCTGTGCACTGC
GTCAATGGCGCCTTTATGAACTCTGGACAGATTTGCATGTCGACGGAGCGCATCCTCGTGCACCAGTCCATCGCC
GACAAGTTCCGCAACATGCTCGTTGCAAAAACCAAGGAAAAGTACAACTCATCCAGCTCAACGCCCACCCTCATC
AACCCCACAGCAGCATCACGAAACCGCAACCTGATATCGCAGGCCGTCGAAAAGGGTGCCCGTCTCCTCCCCATC
TTTGCGGAAAAGGAGGCCGATACACCAAGCGGGATGCAGGCTGTGGTTCTCGAAAACGTCAACAGCAGCATGGAC
ATCTACGGCACCGAATCCTTCGGCCCGAGCGTCTCCCTCTTCACCTTTGAATCCGAGGCCGAGGCCATCAAGCTA
GCCAACGACAGCGAGTACGGCCTCACGGCGGCCGTCTTCTCGGAGGATCTCAGGGCTGCGTTCCGGACGGCTGAT
GCGCTCGAATCCGGAGCTGTGCACATTAACTCGATGACGGTCCATGACGAGAGCTCTATTCCGCACGGGGGAGTT
AAGAATAGCGGCTTTGGGCGCTTCAACTCTAGTCAGGGGCTGGATGAGTTTATGTACTACAAGTCTGTGACGTGG
ATGGAGTAG
Gene >Ophcf2|04114
ATGGCCCTCGAAAACGTCGTTCCCCTCGTCATCAACGGCAAAGATGTGACGACTACAACGACATTCCCCGTAACC
AACCCGGCCACCAACGAGCAGATATGGACCATGTCGTGTGCAGACAAGGACCACGTCCAAGAGGCCGTTCGGACC
GCGCATGAAGCCTTTGAGAAATGGTCACGCTCCAAAGCTGCTTACCGCCGCGACCTGTTCCTTCGCGCTGCCGAT
GTCATGGTTCGACGTCGGACTGAGCTGACGGGCTACATGCGTGATGAGGTAGCGTTCGAAGCCGACTTTCAGGCC
TTTATATTCGATGCCTGTGTGGATTTCCTCCGCGACATTGCTGGGAGGCTCGTCCAGGCCGTCGAAGGCTCAGTT
CCCGAGTCCATCATACCCGGCATGAGGGCCATGGTCTGCAAGAGACCGTACGGCGTCATCCTCGGCACCGGTTCA
TGGTGAGGATGAGTCGTGAAACTCATCCACGCGGAGCTGATTCAACCATGTTAGGAACGGAGCTCTCCTACTGGG
TCTACGATCCGTCGCGTACGCCCTCGCAGCCGGCAACACAGCCATCTTCAAGGGCTCCGAGCTCTCTCCCAAATG
TCATTGGGCCATCGCCGACGTCTTCCGCGAGGCCGGCTTGCCAGACGGCTGCCTGAATTTCATCTTGCACTCGCC
CTCAGACGCCGAGACCATCACCGACGCGCTCGTCGCCCATCCGCTGGTCAAGAAGATCAACTTTACCGGCAGCAC
CCGCGTCGGCCGGCTCATTGCCGCAAATGCCGGGAAGCATCTGAAGCCGGTTCTGCTGGAACTTGGTGGAAAGGC
GAGCGCCATTGTGCTAAAGGACGCCGACCTCGAGAACGCGGCTGTGCACTGCGTCAATGGCGCCTTTATGAACGT
ATGTGCTTGTTCTCTACTTTTCTCTTCGTGGCTGATGACCGTCTTCGGCTTCCATAGTCTGGACAGATTTGCATG
TCGACGGAGCGCATCCTCGTGCACCAGTCCATCGCCGACAAGTTCCGCAACATGCTCGTTGCAAAAACCAAGGAA
AAGTACAACTCATCCAGCTCAACGCCCACCCTCATCAACCCCACAGCAGCATCACGAAACCGCAACCTGATATCG
CAGGCCGTCGAAAAGGGTGCCCGTCTCCTCCCCATCTTTGCGGAAAAGGAGGCCGATACACCAAGCGGGATGCAG
GCTGTGGTTCTCGAAAACGTCAACAGCAGCATGGACATCTACGGCACCGAATCCTTCGGCCCGAGCGTCTCCCTC
TTCACCTTTGAATCCGAGGCCGAGGCCATCAAGCTAGCCAACGACAGCGAGTACGGCCTCACGGCGGCCGTCTTC
TCGGAGGATCTCAGGGCTGCGTTCCGGACGGCTGATGCGCTCGAATCCGGAGCTGTGCACATTAACTCGATGACG
GTCCATGACGAGAGCTCTATTCCGCACGGGGGAGTTAAGAATAGCGGCTTTGGGCGCTTCAACTCTAGTCAGGGG
CTGGATGAGTTTATGTACTACAAGTCTGTGACGTGGATGGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail