Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04104
Gene name
Locationscaffold_04:869330..869966
Strand-
Gene length (bp)636
Transcript length (bp)396
Coding sequence length (bp)396
Protein length (aa) 132

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08507 COPI_assoc COPI associated protein 6.7E-32 6 122

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 33 52 19
3 64 86 22
4 90 112 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 184.67 96.74 272.61
Alive In ants, during behavior modification 235.96 128.24 343.68
Dead In ants, recently dead 203.25 107.89 298.60

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.245321 no
Alive Dead 0.445531 no
Dead Fungus 0.702968 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04104
MELSDTFRMVNLGVGAITVLGGIAQIFGFKLQTIVVGAYMIVFGLAIALLEFQIPPQIARYASFLFSFIGRGAFY
IFIGCLLLGGMILQNIAGGVVGIVGLGYVILEFIPSIEPPANMREADVGGWTAEQV*
Coding >Ophcf2|04104
ATGGAGCTGTCGGATACATTTCGCATGGTCAACCTCGGGGTCGGAGCCATTACCGTCCTGGGAGGGATTGCGCAA
ATCTTCGGCTTCAAGCTCCAGACCATCGTCGTCGGCGCTTACATGATCGTCTTCGGCCTCGCCATTGCCCTCCTA
GAATTCCAGATCCCTCCTCAAATCGCACGATATGCCTCCTTCCTCTTCTCCTTCATCGGTCGCGGCGCCTTCTAC
ATCTTCATCGGCTGTCTCCTCCTCGGCGGCATGATCCTACAAAACATCGCCGGTGGCGTCGTCGGCATCGTCGGC
CTCGGATACGTCATCCTCGAGTTTATCCCTTCCATCGAGCCCCCTGCGAATATGCGCGAAGCCGATGTCGGTGGC
TGGACGGCAGAGCAGGTGTAG
Transcript >Ophcf2|04104
ATGGAGCTGTCGGATACATTTCGCATGGTCAACCTCGGGGTCGGAGCCATTACCGTCCTGGGAGGGATTGCGCAA
ATCTTCGGCTTCAAGCTCCAGACCATCGTCGTCGGCGCTTACATGATCGTCTTCGGCCTCGCCATTGCCCTCCTA
GAATTCCAGATCCCTCCTCAAATCGCACGATATGCCTCCTTCCTCTTCTCCTTCATCGGTCGCGGCGCCTTCTAC
ATCTTCATCGGCTGTCTCCTCCTCGGCGGCATGATCCTACAAAACATCGCCGGTGGCGTCGTCGGCATCGTCGGC
CTCGGATACGTCATCCTCGAGTTTATCCCTTCCATCGAGCCCCCTGCGAATATGCGCGAAGCCGATGTCGGTGGC
TGGACGGCAGAGCAGGTGTAG
Gene >Ophcf2|04104
ATGGAGCTGTCGGATACATTGTGCGTGTGTCTCGTCTGCAGGGCTTTTCGCGGTGGATGCTGACGCGCGGCATTG
CCAGTCGCATGGTCAACCTCGGGGTCGGAGCCATTACCGTCCTGGGAGGGATTGCGCAAATCTTCGGCTTCAAGC
TGTGGGTTGCATATGCTTTTCTTGTCGTCTTCTCCTTTTGCGGCTGTGCTGATTATCTTGGTTAGCCAGACCATC
GTCGTCGGCGCTTACATGATCGTCTTCGGCCTCGCCATTGCCCTCCTAGGTTCGTCGCCTTACCATCCTCTCCAT
CGACTCCTCAACTAACGCCCTCTAGAATTCCAGATCCCTCCTCAAATCGCACGATATGCCTCCTTCCTCTTCTCC
TTCATCGGTCGCGGCGCCTGTTCGTCCCTGCATCCCCCCCCCCCCCAAAAAAAAAAACATCCTAGCTAACCCCCC
TCGCCAACAGTCTACATCTTCATCGGCTGTCTCCTCCTCGGCGGCATGATCCTACAAAACATCGCCGGTGGCGTC
GTCGGCATCGTCGGCCTCGGATACGTCATCCTCGAGTTTATCCCTTCCATCGAGCCCCCTGCGAATATGCGCGAA
GCCGATGTCGGTGGCTGGACGGCAGAGCAGGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail