Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04099
Gene name
Locationscaffold_04:855871..857399
Strand+
Gene length (bp)1528
Transcript length (bp)1404
Coding sequence length (bp)1404
Protein length (aa) 468

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00171 Aldedh Aldehyde dehydrogenase family 1.4E-129 4 459
PF05893 LuxC Acyl-CoA reductase (LuxC) 3.3E-06 111 288

GO

GO Term Description Terminal node
GO:0003995 acyl-CoA dehydrogenase activity Yes
GO:0008218 bioluminescence Yes
GO:0016491 oxidoreductase activity Yes
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors No
GO:0044237 cellular metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.7931 0.1603 0.3478 0.0544 0.3373 0.0138 0.0389 0.056 0.077 0.0804

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4327
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5561
Ophiocordyceps australis map64 (Brazil) OphauB2|2720
Ophiocordyceps camponoti-floridani Ophcf2|04099 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3636
Ophiocordyceps kimflemingae Ophio5|3986
Ophiocordyceps subramaniannii Hirsu2|8891

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04099
MSVETITTISPSTNEPILTRNGASPTDLDSLLRVSGEAFNRFRKTSLADRQRIVKSFLKRLSDRQTELGEEVTAQ
MGRPMAFAAKEVTTAVKRGEYMLKISEEALQDTPGEPEKGFRRFIRKLPVGPVLIIFAWNFPYLTLVNSLIPAIL
VGNSVILKPSPQTPTIAEHVAEMFRESGMPEGVVQYFHCGSPSVMETVVRDPRVALICFTGSVAGGLAVQKAAAD
RVVNVGLELGGKDAAYVRDDVDVDWAAEEVVDGAVFNSGQSCCSVERVYVADKIHDAFVQTVQKVLRGYKLGDPS
DKATHVGPVVSRRAKQTIEEHVSDALAKGAKDATPDNESFGSAPTKGNYVKPTLLTGVDHSMRVMTEETFGPVIP
VMKVQDDDEAIRLMNDSEFGLTASIWTRDTTRGAQLAEEIEAGTVFVNRCDYPSPDLAWTGHKNSGKGQTLGRFG
FEQFVKSKSFHVKDYPK*
Coding >Ophcf2|04099
ATGTCCGTCGAAACCATCACCACCATCTCCCCATCCACCAACGAACCCATCCTCACCCGCAATGGCGCCTCGCCC
ACCGATCTCGACTCGCTTCTCAGGGTCTCCGGCGAAGCCTTCAACCGCTTCCGCAAGACGAGTCTCGCCGATCGT
CAGCGAATCGTCAAGAGCTTCCTCAAGCGCCTCTCCGACCGTCAGACCGAACTTGGAGAAGAGGTGACGGCCCAG
ATGGGGAGACCGATGGCCTTTGCCGCCAAAGAAGTGACGACCGCCGTCAAGCGTGGCGAGTACATGCTCAAGATC
AGCGAAGAGGCGCTTCAGGATACGCCTGGCGAGCCGGAAAAGGGTTTCCGCCGCTTCATCCGCAAGCTGCCCGTC
GGACCGGTGCTCATCATCTTTGCTTGGAATTTTCCCTATCTGACGCTTGTCAACTCGCTGATACCGGCCATCCTG
GTGGGCAACTCGGTCATCCTCAAGCCGTCACCTCAGACGCCAACCATCGCCGAGCACGTGGCCGAAATGTTCCGC
GAGTCGGGCATGCCGGAGGGAGTGGTGCAGTATTTCCACTGCGGTTCACCAAGCGTCATGGAGACGGTCGTTCGA
GATCCGCGCGTGGCCCTCATCTGTTTCACCGGCTCGGTGGCCGGCGGTCTGGCTGTTCAAAAGGCGGCGGCCGAC
AGGGTCGTCAACGTCGGCCTCGAGCTCGGCGGTAAAGACGCAGCCTATGTCAGGGACGACGTCGACGTCGACTGG
GCGGCTGAGGAGGTCGTCGACGGCGCAGTCTTCAACTCGGGGCAGAGCTGCTGCTCGGTAGAACGCGTGTACGTG
GCGGACAAGATACACGACGCCTTTGTGCAGACGGTGCAAAAGGTGCTCCGGGGGTATAAGCTGGGCGACCCGTCA
GACAAGGCGACGCATGTAGGGCCCGTTGTTTCGCGGAGGGCAAAGCAGACGATCGAGGAACACGTCTCGGACGCG
CTCGCCAAGGGGGCGAAGGACGCGACTCCGGATAACGAGAGCTTCGGAAGCGCGCCGACAAAGGGCAACTACGTC
AAGCCTACGCTCCTCACGGGCGTTGATCACAGCATGAGGGTCATGACGGAAGAGACGTTCGGGCCCGTGATACCC
GTCATGAAGGTCCAAGACGACGACGAAGCCATCCGACTGATGAACGATAGCGAGTTCGGACTCACTGCCAGCATC
TGGACTCGCGACACGACGCGCGGCGCACAGCTTGCGGAAGAAATCGAGGCCGGAACCGTCTTCGTCAACCGCTGC
GACTATCCCAGCCCGGATCTTGCCTGGACAGGGCACAAGAATTCGGGCAAGGGCCAGACCTTGGGCCGCTTCGGC
TTCGAGCAGTTCGTCAAGTCAAAGAGCTTCCACGTTAAAGATTACCCGAAATAA
Transcript >Ophcf2|04099
ATGTCCGTCGAAACCATCACCACCATCTCCCCATCCACCAACGAACCCATCCTCACCCGCAATGGCGCCTCGCCC
ACCGATCTCGACTCGCTTCTCAGGGTCTCCGGCGAAGCCTTCAACCGCTTCCGCAAGACGAGTCTCGCCGATCGT
CAGCGAATCGTCAAGAGCTTCCTCAAGCGCCTCTCCGACCGTCAGACCGAACTTGGAGAAGAGGTGACGGCCCAG
ATGGGGAGACCGATGGCCTTTGCCGCCAAAGAAGTGACGACCGCCGTCAAGCGTGGCGAGTACATGCTCAAGATC
AGCGAAGAGGCGCTTCAGGATACGCCTGGCGAGCCGGAAAAGGGTTTCCGCCGCTTCATCCGCAAGCTGCCCGTC
GGACCGGTGCTCATCATCTTTGCTTGGAATTTTCCCTATCTGACGCTTGTCAACTCGCTGATACCGGCCATCCTG
GTGGGCAACTCGGTCATCCTCAAGCCGTCACCTCAGACGCCAACCATCGCCGAGCACGTGGCCGAAATGTTCCGC
GAGTCGGGCATGCCGGAGGGAGTGGTGCAGTATTTCCACTGCGGTTCACCAAGCGTCATGGAGACGGTCGTTCGA
GATCCGCGCGTGGCCCTCATCTGTTTCACCGGCTCGGTGGCCGGCGGTCTGGCTGTTCAAAAGGCGGCGGCCGAC
AGGGTCGTCAACGTCGGCCTCGAGCTCGGCGGTAAAGACGCAGCCTATGTCAGGGACGACGTCGACGTCGACTGG
GCGGCTGAGGAGGTCGTCGACGGCGCAGTCTTCAACTCGGGGCAGAGCTGCTGCTCGGTAGAACGCGTGTACGTG
GCGGACAAGATACACGACGCCTTTGTGCAGACGGTGCAAAAGGTGCTCCGGGGGTATAAGCTGGGCGACCCGTCA
GACAAGGCGACGCATGTAGGGCCCGTTGTTTCGCGGAGGGCAAAGCAGACGATCGAGGAACACGTCTCGGACGCG
CTCGCCAAGGGGGCGAAGGACGCGACTCCGGATAACGAGAGCTTCGGAAGCGCGCCGACAAAGGGCAACTACGTC
AAGCCTACGCTCCTCACGGGCGTTGATCACAGCATGAGGGTCATGACGGAAGAGACGTTCGGGCCCGTGATACCC
GTCATGAAGGTCCAAGACGACGACGAAGCCATCCGACTGATGAACGATAGCGAGTTCGGACTCACTGCCAGCATC
TGGACTCGCGACACGACGCGCGGCGCACAGCTTGCGGAAGAAATCGAGGCCGGAACCGTCTTCGTCAACCGCTGC
GACTATCCCAGCCCGGATCTTGCCTGGACAGGGCACAAGAATTCGGGCAAGGGCCAGACCTTGGGCCGCTTCGGC
TTCGAGCAGTTCGTCAAGTCAAAGAGCTTCCACGTTAAAGATTACCCGAAATAA
Gene >Ophcf2|04099
ATGTCCGTCGAAACCATCACCACCATCTCCCCATCCACCAACGAACCCATCCTCACCCGCAATGGCGCCTCGCCC
ACCGATCTCGACTCGCTTCTCAGGGTCTCCGGCGAAGCCTTCAACCGCTTCCGCAAGACGAGTCTCGCCGATCGT
CAGCGAATCGTCAAGAGCTTCCTCAAGCGCCTCTCCGACCGTCAGACCGAACTTGGAGAAGAGGTGACGGCCCAG
ATGGGGAGACCGATGGCCTTTGCCGCCAAAGAAGTGACGACCGCCGTCAAGCGTGGCGAGTACATGCTCAAGATC
AGCGAAGAGGCGCTTCAGGATACGCCTGGCGAGCCGGAAAAGGGTTTCCGCCGCTTCATCCGCAAGCTGCCCGTC
GGACCGGTGCTCATCATCTTTGCTTGGAATGTGCGTGGCTTCATCGTCTCACTAGGTCCCCGTGATACTCGGTCT
TCTAACTGGTTCTCGCCTTACATATAGTTTCCCTATCTGACGCTTGTCAACTCGCTGATACCGGCCATCCTGGTG
GGCAACTCGGTCATCCTCAAGCCGTCACCTCAGACGCCAACCATCGCCGAGCACGTGGCCGAAATGTTCCGCGAG
TCGGGCATGCCGGAGGGAGTGGTGCAGTATTTCCACTGCGGTTCACCAAGCGTCATGGAGACGGTCGTTCGAGAT
CCGCGCGTGGCCCTCATCTGTTTCACCGGCTCGGTGGCCGGCGGTCTGGCTGTTCAAAAGGCGGCGGCCGACAGG
GTCGTCAACGTCGGCCTCGAGCTCGGCGGTAAAGACGCAGCCTATGTCAGGGACGACGTCGACGTCGACTGGGCG
GCTGAGGAGGTCGTCGACGGCGCAGTCTTCAACTCGGGGCAGAGCTGCTGCTCGGTAGAACGCGTGTACGTGGCG
GACAAGATACACGACGCCTTTGTGCAGACGGTGCAAAAGGTGCTCCGGGGGTATAAGCTGGGCGACCCGTCAGAC
AAGGCGACGCATGTAGGGCCCGTTGTTTCGCGGAGGGCAAAGCAGACGATCGAGGAACACGTCTCGGACGCGCTC
GCCAAGGGGGCGAAGGACGCGACTCCGGATAACGAGAGCTTCGGAAGCGCGCCGACAAAGGGCAACTACGTCAAG
CCTACGCTCCTCACGGGCGTTGATCACAGCATGAGGGTCATGACGGAAGAGACGTTCGGGCCCGTGATACCCGTC
ATGAAGGTCCAAGACGACGACGAAGCCATCCGACTGATGAACGATAGCGAGTTCGGACTCACTGCCAGCATCTGG
ACTCGCGACACGACGCGCGGCGCACAGCTTGCGGAAGAAATCGAGGCCGGAACCGTCTTCGTCAACCGCTGCGAC
TATCCCAGCCCGGTACGACAAGCCTACGGATTCCGGAGGAGACGTATGCTGACGGCGTCAACAGGATCTTGCCTG
GACAGGGCACAAGAATTCGGGCAAGGGCCAGACCTTGGGCCGCTTCGGCTTCGAGCAGTTCGTCAAGTCAAAGAG
CTTCCACGTTAAAGATTACCCGAAATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail