Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04097
Gene name
Locationscaffold_04:852677..854269
Strand-
Gene length (bp)1592
Transcript length (bp)1542
Coding sequence length (bp)1542
Protein length (aa) 514

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04981 NMD3 NMD3 family 4.4E-76 25 255

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear export signal 0.4488 0.7905 0.0173 0.0701 0.0911 0.0006 0.045 0.0736 0.054 0.0019

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4329
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5559
Ophiocordyceps australis map64 (Brazil) OphauB2|2718
Ophiocordyceps camponoti-floridani Ophcf2|04097 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1748
Ophiocordyceps kimflemingae Ophio5|3988
Ophiocordyceps subramaniannii Hirsu2|8893

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04097
MSMDVDEAPMAIGNSPQQTGATILCCNCGAPIDGTTSTGALCFACVKLTVDISQGVQREATLNFCRDCDRWLMPP
TSWVVAMPESRELLALCLKKLRGLNKVRIVDAAFVWTEPHSRRIKVKITIQDSVQDGVLLQQSFEVVYVVATQQC
PECAKSYTANVWRACVQVRQKVLHKRTFLFLEQLIMKHGAHRDTLNIKEAKDGIDFFFSRRNQADKFIDFLNSVV
PVKVKASQELISQDVHTSKKSFKFTYSAELVPICRDDLVAMPIRLAKQCGNISPLVLCHKIGTSVYLVDPQTLQT
TDISAPIYWRAPFASLADSRELVEFVVMDIERTATRKGKWVLAEVTVARASDLGVNDKSYFTRTHLGHYLQTGDS
VMGYMLTGTMFNNADFEAMEESSAYSSTVPDVILVKKHYPRQQRNRRRHWKLRRMDKDEGELLPKKADEDRMARE
YEMFLRDVEEDEELRAALALYKNEKKPDEMSTTETEGDEDEGVPRVNMEELLDDLEDLTVEDR*
Coding >Ophcf2|04097
ATGTCCATGGATGTCGACGAGGCCCCGATGGCCATCGGGAACTCCCCGCAACAGACAGGAGCAACCATCCTCTGC
TGCAACTGCGGCGCCCCCATCGACGGAACCACATCAACAGGCGCCCTATGCTTCGCCTGCGTCAAGCTCACGGTC
GACATCTCCCAGGGCGTCCAGCGCGAAGCGACGCTCAACTTCTGCCGCGACTGCGATAGATGGCTGATGCCCCCG
ACAAGCTGGGTCGTCGCCATGCCCGAATCCCGCGAACTGTTGGCCCTGTGTCTCAAGAAGCTGCGCGGTCTCAAC
AAGGTGCGCATCGTCGACGCCGCTTTCGTCTGGACGGAGCCGCACTCGCGACGGATAAAGGTCAAGATTACCATT
CAGGATTCCGTTCAGGATGGGGTGCTGCTGCAGCAGAGCTTCGAGGTTGTTTACGTCGTCGCGACGCAGCAGTGT
CCTGAGTGCGCCAAGTCGTACACTGCCAATGTCTGGAGGGCTTGTGTACAGGTGCGGCAAAAGGTTCTTCACAAG
CGCACCTTTCTCTTCCTCGAGCAGCTCATCATGAAGCACGGCGCCCACCGCGACACGCTCAACATCAAAGAAGCC
AAGGATGGCATCGATTTCTTCTTCTCCCGAAGAAATCAGGCCGACAAGTTTATCGATTTTCTGAATTCCGTGGTG
CCCGTCAAGGTCAAGGCCTCGCAGGAGCTGATATCACAGGATGTTCACACGTCTAAAAAGTCGTTCAAGTTCACC
TACTCTGCCGAGCTGGTACCTATCTGCAGGGATGATCTGGTCGCCATGCCCATAAGACTCGCCAAGCAATGCGGC
AACATCTCGCCGCTCGTCTTGTGCCACAAGATCGGTACATCGGTTTATCTGGTCGACCCCCAAACGCTGCAGACG
ACCGACATCAGCGCCCCGATCTATTGGCGCGCCCCCTTTGCGTCTCTCGCTGACTCGCGCGAGCTGGTCGAGTTT
GTCGTCATGGACATCGAGCGGACGGCTACCCGGAAGGGTAAATGGGTGCTTGCGGAAGTAACGGTGGCCCGGGCA
TCCGACCTGGGCGTCAACGACAAGTCGTATTTCACACGGACCCATCTCGGCCATTACCTGCAAACGGGCGATTCG
GTCATGGGGTACATGTTGACAGGCACCATGTTCAACAACGCCGACTTTGAGGCCATGGAGGAGTCCAGCGCGTAT
TCCTCGACCGTACCAGACGTCATCTTGGTCAAGAAGCATTACCCCCGTCAACAGAGGAATCGCCGGCGCCATTGG
AAGTTGAGGCGCATGGACAAGGACGAAGGCGAGCTGCTACCCAAGAAGGCCGATGAGGATCGCATGGCGCGCGAG
TACGAGATGTTCCTGCGAGACGTCGAGGAGGACGAGGAGCTCCGTGCGGCCTTGGCCTTGTACAAGAACGAGAAG
AAGCCGGATGAGATGAGCACGACGGAGACGGAGGGGGATGAGGACGAGGGCGTGCCGCGGGTGAATATGGAGGAG
TTGCTGGATGATTTGGAGGATCTCACGGTGGAGGATCGGTAG
Transcript >Ophcf2|04097
ATGTCCATGGATGTCGACGAGGCCCCGATGGCCATCGGGAACTCCCCGCAACAGACAGGAGCAACCATCCTCTGC
TGCAACTGCGGCGCCCCCATCGACGGAACCACATCAACAGGCGCCCTATGCTTCGCCTGCGTCAAGCTCACGGTC
GACATCTCCCAGGGCGTCCAGCGCGAAGCGACGCTCAACTTCTGCCGCGACTGCGATAGATGGCTGATGCCCCCG
ACAAGCTGGGTCGTCGCCATGCCCGAATCCCGCGAACTGTTGGCCCTGTGTCTCAAGAAGCTGCGCGGTCTCAAC
AAGGTGCGCATCGTCGACGCCGCTTTCGTCTGGACGGAGCCGCACTCGCGACGGATAAAGGTCAAGATTACCATT
CAGGATTCCGTTCAGGATGGGGTGCTGCTGCAGCAGAGCTTCGAGGTTGTTTACGTCGTCGCGACGCAGCAGTGT
CCTGAGTGCGCCAAGTCGTACACTGCCAATGTCTGGAGGGCTTGTGTACAGGTGCGGCAAAAGGTTCTTCACAAG
CGCACCTTTCTCTTCCTCGAGCAGCTCATCATGAAGCACGGCGCCCACCGCGACACGCTCAACATCAAAGAAGCC
AAGGATGGCATCGATTTCTTCTTCTCCCGAAGAAATCAGGCCGACAAGTTTATCGATTTTCTGAATTCCGTGGTG
CCCGTCAAGGTCAAGGCCTCGCAGGAGCTGATATCACAGGATGTTCACACGTCTAAAAAGTCGTTCAAGTTCACC
TACTCTGCCGAGCTGGTACCTATCTGCAGGGATGATCTGGTCGCCATGCCCATAAGACTCGCCAAGCAATGCGGC
AACATCTCGCCGCTCGTCTTGTGCCACAAGATCGGTACATCGGTTTATCTGGTCGACCCCCAAACGCTGCAGACG
ACCGACATCAGCGCCCCGATCTATTGGCGCGCCCCCTTTGCGTCTCTCGCTGACTCGCGCGAGCTGGTCGAGTTT
GTCGTCATGGACATCGAGCGGACGGCTACCCGGAAGGGTAAATGGGTGCTTGCGGAAGTAACGGTGGCCCGGGCA
TCCGACCTGGGCGTCAACGACAAGTCGTATTTCACACGGACCCATCTCGGCCATTACCTGCAAACGGGCGATTCG
GTCATGGGGTACATGTTGACAGGCACCATGTTCAACAACGCCGACTTTGAGGCCATGGAGGAGTCCAGCGCGTAT
TCCTCGACCGTACCAGACGTCATCTTGGTCAAGAAGCATTACCCCCGTCAACAGAGGAATCGCCGGCGCCATTGG
AAGTTGAGGCGCATGGACAAGGACGAAGGCGAGCTGCTACCCAAGAAGGCCGATGAGGATCGCATGGCGCGCGAG
TACGAGATGTTCCTGCGAGACGTCGAGGAGGACGAGGAGCTCCGTGCGGCCTTGGCCTTGTACAAGAACGAGAAG
AAGCCGGATGAGATGAGCACGACGGAGACGGAGGGGGATGAGGACGAGGGCGTGCCGCGGGTGAATATGGAGGAG
TTGCTGGATGATTTGGAGGATCTCACGGTGGAGGATCGGTAG
Gene >Ophcf2|04097
ATGTCCATGGATGTCGACGAGGCCCCGATGGCCATCGGGAACTCCCCGCAACAGACAGGAGCAACGTACGTTCAA
CCAGGTCATCCGCTTAGACCCTCCGCTGACGTCCCCCAAGCATCCTCTGCTGCAACTGCGGCGCCCCCATCGACG
GAACCACATCAACAGGCGCCCTATGCTTCGCCTGCGTCAAGCTCACGGTCGACATCTCCCAGGGCGTCCAGCGCG
AAGCGACGCTCAACTTCTGCCGCGACTGCGATAGATGGCTGATGCCCCCGACAAGCTGGGTCGTCGCCATGCCCG
AATCCCGCGAACTGTTGGCCCTGTGTCTCAAGAAGCTGCGCGGTCTCAACAAGGTGCGCATCGTCGACGCCGCTT
TCGTCTGGACGGAGCCGCACTCGCGACGGATAAAGGTCAAGATTACCATTCAGGATTCCGTTCAGGATGGGGTGC
TGCTGCAGCAGAGCTTCGAGGTTGTTTACGTCGTCGCGACGCAGCAGTGTCCTGAGTGCGCCAAGTCGTACACTG
CCAATGTCTGGAGGGCTTGTGTACAGGTGCGGCAAAAGGTTCTTCACAAGCGCACCTTTCTCTTCCTCGAGCAGC
TCATCATGAAGCACGGCGCCCACCGCGACACGCTCAACATCAAAGAAGCCAAGGATGGCATCGATTTCTTCTTCT
CCCGAAGAAATCAGGCCGACAAGTTTATCGATTTTCTGAATTCCGTGGTGCCCGTCAAGGTCAAGGCCTCGCAGG
AGCTGATATCACAGGATGTTCACACGTCTAAAAAGTCGTTCAAGTTCACCTACTCTGCCGAGCTGGTACCTATCT
GCAGGGATGATCTGGTCGCCATGCCCATAAGACTCGCCAAGCAATGCGGCAACATCTCGCCGCTCGTCTTGTGCC
ACAAGATCGGTACATCGGTTTATCTGGTCGACCCCCAAACGCTGCAGACGACCGACATCAGCGCCCCGATCTATT
GGCGCGCCCCCTTTGCGTCTCTCGCTGACTCGCGCGAGCTGGTCGAGTTTGTCGTCATGGACATCGAGCGGACGG
CTACCCGGAAGGGTAAATGGGTGCTTGCGGAAGTAACGGTGGCCCGGGCATCCGACCTGGGCGTCAACGACAAGT
CGTATTTCACACGGACCCATCTCGGCCATTACCTGCAAACGGGCGATTCGGTCATGGGGTACATGTTGACAGGCA
CCATGTTCAACAACGCCGACTTTGAGGCCATGGAGGAGTCCAGCGCGTATTCCTCGACCGTACCAGACGTCATCT
TGGTCAAGAAGCATTACCCCCGTCAACAGAGGAATCGCCGGCGCCATTGGAAGTTGAGGCGCATGGACAAGGACG
AAGGCGAGCTGCTACCCAAGAAGGCCGATGAGGATCGCATGGCGCGCGAGTACGAGATGTTCCTGCGAGACGTCG
AGGAGGACGAGGAGCTCCGTGCGGCCTTGGCCTTGTACAAGAACGAGAAGAAGCCGGATGAGATGAGCACGACGG
AGACGGAGGGGGATGAGGACGAGGGCGTGCCGCGGGTGAATATGGAGGAGTTGCTGGATGATTTGGAGGATCTCA
CGGTGGAGGATCGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail