Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04089
Gene name
Locationscaffold_04:833600..834379
Strand-
Gene length (bp)779
Transcript length (bp)726
Coding sequence length (bp)726
Protein length (aa) 242

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13881 Rad60-SLD_2 Ubiquitin-2 like Rad60 SUMO-like 3.0E-12 144 216

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane 0.2903 0.3545 0.0627 0.5023 0.2348 0.0051 0.3986 0.2861 0.2941 0.2134

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3912
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|556
Ophiocordyceps australis map64 (Brazil) OphauB2|2709
Ophiocordyceps camponoti-floridani Ophcf2|04089 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4222
Ophiocordyceps kimflemingae Ophio5|3752
Ophiocordyceps subramaniannii Hirsu2|7790

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04089
MSGGNSSSSDAAPHPAPVGDAVPMEEMARHADADADEAAPSTSHSDAADAAPPTASTTDTSKGKDRDPDALSKQR
RESIAAIGPAQDDNRHTAPMGDDGGPVCIITLLLTSGSRHPYKIDARYLARRNVVIPDETEDGHPDPFSISVYTL
KELILREWRNDWETKPNSPSSIRLIHFGKLLDDKEQLKKYQFSTENPNVVHMSIRPSDLDEEEPKSGGKSLPAGS
GDGQRSRSGNGCCTIL*
Coding >Ophcf2|04089
ATGAGCGGCGGCAACAGCTCGTCGTCGGATGCCGCTCCGCATCCTGCCCCCGTCGGAGACGCCGTCCCTATGGAG
GAAATGGCTCGGCACGCCGACGCCGACGCCGACGAGGCCGCGCCCTCGACTTCTCACAGTGACGCTGCCGATGCT
GCGCCCCCTACCGCCAGTACCACCGACACGTCAAAGGGCAAAGACAGGGATCCAGACGCGCTTTCTAAGCAGAGG
CGTGAGTCCATCGCGGCAATCGGCCCGGCCCAGGATGACAACAGGCACACTGCCCCTATGGGAGACGATGGCGGT
CCCGTCTGCATCATTACGCTTCTGTTGACGTCCGGGAGCCGCCATCCTTACAAGATCGATGCCAGGTACTTAGCG
CGGAGGAACGTCGTCATACCCGACGAGACGGAAGACGGTCATCCGGACCCTTTCAGCATCAGCGTCTACACCTTG
AAGGAGCTCATCCTGCGGGAGTGGCGCAACGATTGGGAGACCAAGCCCAACAGTCCGAGCAGCATCCGGCTCATT
CACTTTGGAAAGCTCCTGGATGATAAGGAGCAGCTGAAGAAGTACCAATTCAGTACCGAGAACCCCAACGTCGTT
CACATGAGCATCCGCCCTTCGGATCTCGACGAAGAGGAACCCAAGTCCGGGGGGAAGAGTCTCCCGGCGGGTAGC
GGAGACGGGCAGCGGTCTCGGTCTGGCAATGGCTGCTGCACCATCTTATGA
Transcript >Ophcf2|04089
ATGAGCGGCGGCAACAGCTCGTCGTCGGATGCCGCTCCGCATCCTGCCCCCGTCGGAGACGCCGTCCCTATGGAG
GAAATGGCTCGGCACGCCGACGCCGACGCCGACGAGGCCGCGCCCTCGACTTCTCACAGTGACGCTGCCGATGCT
GCGCCCCCTACCGCCAGTACCACCGACACGTCAAAGGGCAAAGACAGGGATCCAGACGCGCTTTCTAAGCAGAGG
CGTGAGTCCATCGCGGCAATCGGCCCGGCCCAGGATGACAACAGGCACACTGCCCCTATGGGAGACGATGGCGGT
CCCGTCTGCATCATTACGCTTCTGTTGACGTCCGGGAGCCGCCATCCTTACAAGATCGATGCCAGGTACTTAGCG
CGGAGGAACGTCGTCATACCCGACGAGACGGAAGACGGTCATCCGGACCCTTTCAGCATCAGCGTCTACACCTTG
AAGGAGCTCATCCTGCGGGAGTGGCGCAACGATTGGGAGACCAAGCCCAACAGTCCGAGCAGCATCCGGCTCATT
CACTTTGGAAAGCTCCTGGATGATAAGGAGCAGCTGAAGAAGTACCAATTCAGTACCGAGAACCCCAACGTCGTT
CACATGAGCATCCGCCCTTCGGATCTCGACGAAGAGGAACCCAAGTCCGGGGGGAAGAGTCTCCCGGCGGGTAGC
GGAGACGGGCAGCGGTCTCGGTCTGGCAATGGCTGCTGCACCATCTTATGA
Gene >Ophcf2|04089
ATGAGCGGCGGCAACAGCTCGTCGTCGGATGCCGCTCCGCATCCTGCCCCCGTCGGAGACGCCGTCCCTATGGAG
GAAATGGCTCGGCACGCCGACGCCGACGCCGACGAGGCCGCGCCCTCGACTTCTCACAGTGACGCTGCCGATGCT
GCGCCCCCTACCGCCAGTACCACCGACACGTCAAAGGGCAAAGACAGGGATCCAGACGCGCTTTCTAAGCAGAGG
CGTGAGTCCATCGCGGCAATCGGCCCGGCCCAGGATGACAACAGGCACACTGCCCCTATGGGAGACGATGGCGGT
CCCGTCTGCATCATTACGCTTCTGTTGACGTCCGGGAGCCGCCATCCTTACAAGATCGATGCCAGGTACTTAGCG
CGGAGGAACGTCGTCATACCCGACGAGACGGAAGACGGTCATCCGGACCCTTTCAGCATCAGCGTCTACACCTTG
AAGGAGCTCATCCTGCGGGAGTGGCGCAACGATTGGGAGACCAAGCCCAACAGTCCGAGCAGCATCCGGCTCATT
CACTTTGGAAAGCTCCTGGATGATAAGGAGCAGCTGAAGAGTAAGACGTGCTGTGTCGTTGATGGTGTCTCATCA
TGTGCTAACGCCGCGCAGAGTACCAATTCAGTACCGAGAACCCCAACGTCGTTCACATGAGCATCCGCCCTTCGG
ATCTCGACGAAGAGGAACCCAAGTCCGGGGGGAAGAGTCTCCCGGCGGGTAGCGGAGACGGGCAGCGGTCTCGGT
CTGGCAATGGCTGCTGCACCATCTTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail