Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04068
Gene name
Locationscaffold_04:771752..772628
Strand+
Gene length (bp)876
Transcript length (bp)690
Coding sequence length (bp)690
Protein length (aa) 230

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08294 TIM21 TIM21 4.1E-42 65 208

GO

GO Term Description Terminal node
GO:0030150 protein import into mitochondrial matrix Yes
GO:0005744 TIM23 mitochondrial import inner membrane translocase complex Yes
GO:0033036 macromolecule localization No
GO:0072594 establishment of protein localization to organelle No
GO:0033365 protein localization to organelle No
GO:0065002 intracellular protein transmembrane transport No
GO:0006886 intracellular protein transport No
GO:0008104 protein localization No
GO:0071702 organic substance transport No
GO:0051649 establishment of localization in cell No
GO:0098798 mitochondrial protein-containing complex No
GO:0032991 protein-containing complex No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0070727 cellular macromolecule localization No
GO:0051234 establishment of localization No
GO:1990542 mitochondrial transmembrane transport No
GO:0071806 protein transmembrane transport No
GO:0015031 protein transport No
GO:0070585 protein localization to mitochondrion No
GO:0005575 cellular_component No
GO:0006839 mitochondrial transport No
GO:0098800 inner mitochondrial membrane protein complex No
GO:0071705 nitrogen compound transport No
GO:0044743 protein transmembrane import into intracellular organelle No
GO:0072655 establishment of protein localization to mitochondrion No
GO:0098796 membrane protein complex No
GO:0045184 establishment of protein localization No
GO:0055085 transmembrane transport No
GO:0008150 biological_process No
GO:0046907 intracellular transport No
GO:0051179 localization No
GO:0051641 cellular localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 73 95 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 98.98 54.32 143.64
Alive In ants, during behavior modification 53.50 25.80 81.19
Dead In ants, recently dead 46.67 22.09 71.25

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.004221 yes
Alive Dead 0.533258 no
Dead Fungus 0.000454 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04068
MRPNLLLRTTRLGACSTSFSGLASRTYSSQTGLGAAAAPKQRRQSITPFNDNGSVPWRELSVTEKMARTTQQGFN
GGLVAIGLVLTGTVVYFLWTDVFSPDSKISQFNRAVDRIKKDPRCIQLLGEAHRITAHGEETMNKWRRARPLSYS
EKVDARGDSHLMMHFYVDGPLQNGVAQLHMVKRQGESDYEYRYFFVDVKGHERVYLEKATSESGPGKKQLSLFGV
KWGR*
Coding >Ophcf2|04068
ATGAGGCCGAATCTCCTATTGCGGACCACTCGTTTGGGCGCATGCTCCACCTCCTTTTCAGGGCTCGCCTCCAGG
ACGTATAGCTCACAGACTGGCCTCGGAGCTGCGGCCGCGCCGAAGCAGAGACGACAGAGCATCACGCCGTTCAAC
GACAATGGATCGGTGCCGTGGAGAGAGCTCTCGGTGACGGAGAAGATGGCTCGGACGACGCAGCAGGGCTTCAAC
GGCGGCTTGGTCGCCATCGGCCTCGTGCTAACGGGGACCGTCGTCTATTTCCTCTGGACAGACGTCTTTTCTCCC
GACAGCAAGATATCTCAATTCAACCGCGCCGTCGACAGAATCAAGAAAGACCCCAGGTGCATCCAGCTGCTAGGA
GAGGCCCATAGGATCACAGCCCACGGAGAAGAAACGATGAACAAGTGGCGGCGAGCTCGCCCTCTCTCGTACTCT
GAAAAAGTGGACGCTCGGGGAGACTCGCATCTGATGATGCACTTTTACGTCGATGGACCTCTGCAGAACGGCGTC
GCGCAGCTTCACATGGTCAAGCGACAGGGCGAGAGCGACTATGAGTACAGGTATTTCTTCGTGGACGTCAAGGGG
CATGAGCGCGTCTACCTGGAAAAGGCCACGTCCGAGTCGGGCCCGGGGAAGAAGCAGCTGAGTCTCTTCGGCGTC
AAATGGGGCCGATGA
Transcript >Ophcf2|04068
ATGAGGCCGAATCTCCTATTGCGGACCACTCGTTTGGGCGCATGCTCCACCTCCTTTTCAGGGCTCGCCTCCAGG
ACGTATAGCTCACAGACTGGCCTCGGAGCTGCGGCCGCGCCGAAGCAGAGACGACAGAGCATCACGCCGTTCAAC
GACAATGGATCGGTGCCGTGGAGAGAGCTCTCGGTGACGGAGAAGATGGCTCGGACGACGCAGCAGGGCTTCAAC
GGCGGCTTGGTCGCCATCGGCCTCGTGCTAACGGGGACCGTCGTCTATTTCCTCTGGACAGACGTCTTTTCTCCC
GACAGCAAGATATCTCAATTCAACCGCGCCGTCGACAGAATCAAGAAAGACCCCAGGTGCATCCAGCTGCTAGGA
GAGGCCCATAGGATCACAGCCCACGGAGAAGAAACGATGAACAAGTGGCGGCGAGCTCGCCCTCTCTCGTACTCT
GAAAAAGTGGACGCTCGGGGAGACTCGCATCTGATGATGCACTTTTACGTCGATGGACCTCTGCAGAACGGCGTC
GCGCAGCTTCACATGGTCAAGCGACAGGGCGAGAGCGACTATGAGTACAGGTATTTCTTCGTGGACGTCAAGGGG
CATGAGCGCGTCTACCTGGAAAAGGCCACGTCCGAGTCGGGCCCGGGGAAGAAGCAGCTGAGTCTCTTCGGCGTC
AAATGGGGCCGATGA
Gene >Ophcf2|04068
ATGAGGCCGAATCTCCTATTGCGGACCACTCGTTTGGGCGCATGCTCCACCTCCTTTTCAGGGCTCGCCTCCAGG
ACGTATAGCTCACAGACTGGCCTCGGAGCTGCGGCCGCGCCGAAGCAGAGACGACAGAGCATCACGCCGTTCAAC
GACAATGGATCGGTGCCGTGGAGAGAGCTCTCGGTGACGGAGAAGATGGCTCGGACGACGCAGCAGGGCTTCAAC
GGCGGCTTGGTCGCCATCGGCCTCGTGCTAACGGTACGGCCTCCCCAGTCTACCCTCGCCGGCCGACCGCTGACA
CCAGCCAGGGGACCGTCGTCTATTTCCTCTGGACAGACGTCTTTTCTCCCGACAGCAAGATATCTCAATTCAACC
GCGCCGTCGACAGAATCAAGAAAGACCCCAGGTGCATCCAGCTGCTAGGAGAGGCCCATAGGATCACAGCCCACG
GAGAAGAAACGATGAACAAGTGGCGGCGAGCTCGCCCTCTCTCGTGAGTCGCCCCTTTTTTATCTTCTGTACATG
CATACATCCTTTACTCGGGGAGTCGCTAACATCCATGCAAGGTACTCTGAAAAAGTGGACGCTCGGGGAGACTCG
CATCTGATGATGCACTTTTACGTGAGTGCGGCCGCACCGCAGACGGGCACAGACGAGGCGCTGACGAACGACGAC
GACGGTCAGGTCGATGGACCTCTGCAGAACGGCGTCGCGCAGCTTCACATGGTCAAGCGACAGGGCGAGAGCGAC
TATGAGTACAGGTATTTCTTCGTGGACGTCAAGGGGCATGAGCGCGTCTACCTGGAAAAGGCCACGTCCGAGTCG
GGCCCGGGGAAGAAGCAGCTGAGTCTCTTCGGCGTCAAATGGGGCCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail