Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04068
Gene name
Locationscaffold_04:771752..772628
Strand+
Gene length (bp)876
Transcript length (bp)690
Coding sequence length (bp)690
Protein length (aa) 230

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08294 TIM21 TIM21 4.1E-42 65 208

GO

GO Term Description Terminal node
GO:0030150 protein import into mitochondrial matrix Yes
GO:0005744 TIM23 mitochondrial import inner membrane translocase complex Yes
GO:0033036 macromolecule localization No
GO:0072594 establishment of protein localization to organelle No
GO:0033365 protein localization to organelle No
GO:0065002 intracellular protein transmembrane transport No
GO:0006886 intracellular protein transport No
GO:0008104 protein localization No
GO:0071702 organic substance transport No
GO:0051649 establishment of localization in cell No
GO:0098798 mitochondrial protein-containing complex No
GO:0032991 protein-containing complex No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0070727 cellular macromolecule localization No
GO:0051234 establishment of localization No
GO:1990542 mitochondrial transmembrane transport No
GO:0071806 protein transmembrane transport No
GO:0015031 protein transport No
GO:0070585 protein localization to mitochondrion No
GO:0005575 cellular_component No
GO:0006839 mitochondrial transport No
GO:0098800 inner mitochondrial membrane protein complex No
GO:0071705 nitrogen compound transport No
GO:0044743 protein transmembrane import into intracellular organelle No
GO:0072655 establishment of protein localization to mitochondrion No
GO:0098796 membrane protein complex No
GO:0045184 establishment of protein localization No
GO:0055085 transmembrane transport No
GO:0008150 biological_process No
GO:0046907 intracellular transport No
GO:0051179 localization No
GO:0051641 cellular localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 73 95 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04068
MRPNLLLRTTRLGACSTSFSGLASRTYSSQTGLGAAAAPKQRRQSITPFNDNGSVPWRELSVTEKMARTTQQGFN
GGLVAIGLVLTGTVVYFLWTDVFSPDSKISQFNRAVDRIKKDPRCIQLLGEAHRITAHGEETMNKWRRARPLSYS
EKVDARGDSHLMMHFYVDGPLQNGVAQLHMVKRQGESDYEYRYFFVDVKGHERVYLEKATSESGPGKKQLSLFGV
KWGR*
Coding >Ophcf2|04068
ATGAGGCCGAATCTCCTATTGCGGACCACTCGTTTGGGCGCATGCTCCACCTCCTTTTCAGGGCTCGCCTCCAGG
ACGTATAGCTCACAGACTGGCCTCGGAGCTGCGGCCGCGCCGAAGCAGAGACGACAGAGCATCACGCCGTTCAAC
GACAATGGATCGGTGCCGTGGAGAGAGCTCTCGGTGACGGAGAAGATGGCTCGGACGACGCAGCAGGGCTTCAAC
GGCGGCTTGGTCGCCATCGGCCTCGTGCTAACGGGGACCGTCGTCTATTTCCTCTGGACAGACGTCTTTTCTCCC
GACAGCAAGATATCTCAATTCAACCGCGCCGTCGACAGAATCAAGAAAGACCCCAGGTGCATCCAGCTGCTAGGA
GAGGCCCATAGGATCACAGCCCACGGAGAAGAAACGATGAACAAGTGGCGGCGAGCTCGCCCTCTCTCGTACTCT
GAAAAAGTGGACGCTCGGGGAGACTCGCATCTGATGATGCACTTTTACGTCGATGGACCTCTGCAGAACGGCGTC
GCGCAGCTTCACATGGTCAAGCGACAGGGCGAGAGCGACTATGAGTACAGGTATTTCTTCGTGGACGTCAAGGGG
CATGAGCGCGTCTACCTGGAAAAGGCCACGTCCGAGTCGGGCCCGGGGAAGAAGCAGCTGAGTCTCTTCGGCGTC
AAATGGGGCCGATGA
Transcript >Ophcf2|04068
ATGAGGCCGAATCTCCTATTGCGGACCACTCGTTTGGGCGCATGCTCCACCTCCTTTTCAGGGCTCGCCTCCAGG
ACGTATAGCTCACAGACTGGCCTCGGAGCTGCGGCCGCGCCGAAGCAGAGACGACAGAGCATCACGCCGTTCAAC
GACAATGGATCGGTGCCGTGGAGAGAGCTCTCGGTGACGGAGAAGATGGCTCGGACGACGCAGCAGGGCTTCAAC
GGCGGCTTGGTCGCCATCGGCCTCGTGCTAACGGGGACCGTCGTCTATTTCCTCTGGACAGACGTCTTTTCTCCC
GACAGCAAGATATCTCAATTCAACCGCGCCGTCGACAGAATCAAGAAAGACCCCAGGTGCATCCAGCTGCTAGGA
GAGGCCCATAGGATCACAGCCCACGGAGAAGAAACGATGAACAAGTGGCGGCGAGCTCGCCCTCTCTCGTACTCT
GAAAAAGTGGACGCTCGGGGAGACTCGCATCTGATGATGCACTTTTACGTCGATGGACCTCTGCAGAACGGCGTC
GCGCAGCTTCACATGGTCAAGCGACAGGGCGAGAGCGACTATGAGTACAGGTATTTCTTCGTGGACGTCAAGGGG
CATGAGCGCGTCTACCTGGAAAAGGCCACGTCCGAGTCGGGCCCGGGGAAGAAGCAGCTGAGTCTCTTCGGCGTC
AAATGGGGCCGATGA
Gene >Ophcf2|04068
ATGAGGCCGAATCTCCTATTGCGGACCACTCGTTTGGGCGCATGCTCCACCTCCTTTTCAGGGCTCGCCTCCAGG
ACGTATAGCTCACAGACTGGCCTCGGAGCTGCGGCCGCGCCGAAGCAGAGACGACAGAGCATCACGCCGTTCAAC
GACAATGGATCGGTGCCGTGGAGAGAGCTCTCGGTGACGGAGAAGATGGCTCGGACGACGCAGCAGGGCTTCAAC
GGCGGCTTGGTCGCCATCGGCCTCGTGCTAACGGTACGGCCTCCCCAGTCTACCCTCGCCGGCCGACCGCTGACA
CCAGCCAGGGGACCGTCGTCTATTTCCTCTGGACAGACGTCTTTTCTCCCGACAGCAAGATATCTCAATTCAACC
GCGCCGTCGACAGAATCAAGAAAGACCCCAGGTGCATCCAGCTGCTAGGAGAGGCCCATAGGATCACAGCCCACG
GAGAAGAAACGATGAACAAGTGGCGGCGAGCTCGCCCTCTCTCGTGAGTCGCCCCTTTTTTATCTTCTGTACATG
CATACATCCTTTACTCGGGGAGTCGCTAACATCCATGCAAGGTACTCTGAAAAAGTGGACGCTCGGGGAGACTCG
CATCTGATGATGCACTTTTACGTGAGTGCGGCCGCACCGCAGACGGGCACAGACGAGGCGCTGACGAACGACGAC
GACGGTCAGGTCGATGGACCTCTGCAGAACGGCGTCGCGCAGCTTCACATGGTCAAGCGACAGGGCGAGAGCGAC
TATGAGTACAGGTATTTCTTCGTGGACGTCAAGGGGCATGAGCGCGTCTACCTGGAAAAGGCCACGTCCGAGTCG
GGCCCGGGGAAGAAGCAGCTGAGTCTCTTCGGCGTCAAATGGGGCCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail