Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04065
Gene name
Locationscaffold_04:765677..767208
Strand-
Gene length (bp)1531
Transcript length (bp)1407
Coding sequence length (bp)1407
Protein length (aa) 469

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00809 Pterin_bind Pterin binding enzyme 7.8E-79 200 445
PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK) 6.1E-35 25 151

GO

GO Term Description Terminal node
GO:0042558 pteridine-containing compound metabolic process Yes
GO:0009396 folic acid-containing compound biosynthetic process Yes
GO:0003848 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase activity Yes
GO:1901576 organic substance biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0009058 biosynthetic process No
GO:0016740 transferase activity No
GO:0016778 diphosphotransferase activity No
GO:0046483 heterocycle metabolic process No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006760 folic acid-containing compound metabolic process No
GO:0006575 cellular modified amino acid metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009987 cellular process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044237 cellular metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0042398 cellular modified amino acid biosynthetic process No
GO:0003674 molecular_function No
GO:0044249 cellular biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0042559 pteridine-containing compound biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.123 0.1039 0.0786 0.0415 0.8606 0.4427 0.0348 0.0659 0.103 0.0915

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup687
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5873
Ophiocordyceps australis map64 (Brazil) OphauB2|2686
Ophiocordyceps camponoti-floridani Ophcf2|04065 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6024
Ophiocordyceps kimflemingae Ophio5|6569
Ophiocordyceps subramaniannii Hirsu2|1121

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04065
MSPSLLRVRSPWTLLGSRSASTKAYIALGSNVGDRIAAIETACREMDRRGMRVRRTSSLWETPPMYVTDQGRFIN
GACEIETDLGPFALLDELQRIERDMGRRKVVDKGPRNIDLDILLYGDVSISDQRLTVPHAGIAEREFVLRPLAQL
MARQPLFASRPQKLVQDYLDELPPGEALSTVTPLAARGGFLRPNRETHVMAIVNLTPDSFSDGGRHNMSNLASTV
VEMLRGGATMIDVGGQSTAPGRRAVTAEEEASRVVPAIELIRSLPEARDAVISVDTYRASVAEKAVASGADMVND
VSAGTLDADMLPTVARLGKTICLMHMRGTPQTMMSQTAYPNGLIPTTASELEARVAAAQEAGVRRWRIVVDPGIG
FAKTAEQNMQLLARLEELRRSRGLEGLPWLVGVSRKGFVGRVTGASDRVWGTAAAVAAAVGGGADVVRVHDVCEM
SAVAAMADAIWRGVVKGG*
Coding >Ophcf2|04065
ATGAGCCCGTCCCTCCTCCGGGTCCGGTCTCCGTGGACGCTCCTCGGCAGCCGCTCAGCCTCGACAAAGGCCTAC
ATCGCGCTGGGCAGCAACGTGGGCGACCGAATCGCAGCCATCGAGACGGCCTGTCGCGAGATGGACCGTCGCGGC
ATGCGCGTCAGGCGTACCAGCAGCCTGTGGGAGACGCCGCCCATGTACGTGACGGATCAAGGACGGTTCATCAAC
GGCGCCTGCGAGATCGAGACGGACTTGGGTCCTTTTGCTTTGCTGGATGAGCTTCAGCGGATTGAGAGGGACATG
GGACGCCGGAAGGTGGTTGATAAGGGTCCTCGCAACATTGATCTCGACATTCTCTTGTATGGAGATGTTTCGATT
TCCGACCAGCGACTTACGGTGCCTCATGCTGGGATAGCCGAGCGCGAGTTTGTCCTGCGGCCTCTCGCCCAGCTG
ATGGCTCGTCAGCCGCTGTTCGCATCGCGGCCGCAGAAGCTGGTGCAGGATTACCTCGACGAGCTGCCACCTGGC
GAGGCGCTTTCCACAGTGACGCCACTGGCGGCCCGAGGCGGCTTCCTCAGGCCGAACCGCGAGACGCACGTCATG
GCGATTGTGAACCTCACGCCCGACTCCTTCTCGGACGGGGGCCGTCACAACATGAGCAACCTGGCGAGCACCGTG
GTCGAAATGCTACGCGGGGGAGCCACCATGATCGACGTCGGCGGACAATCGACAGCGCCCGGACGACGGGCCGTG
ACGGCGGAAGAGGAGGCGTCGCGGGTGGTGCCGGCCATTGAGCTCATACGATCGCTCCCCGAGGCGCGCGATGCC
GTCATCAGCGTCGACACGTATCGAGCCTCGGTGGCCGAGAAGGCGGTGGCCAGCGGAGCCGACATGGTCAACGAC
GTCTCGGCCGGCACGCTGGACGCGGACATGCTCCCGACGGTAGCCAGGCTGGGGAAGACCATCTGCCTGATGCAC
ATGCGCGGCACACCGCAGACGATGATGTCGCAGACGGCCTACCCGAACGGCCTCATCCCCACGACGGCATCGGAG
CTCGAGGCGCGGGTGGCGGCGGCGCAAGAGGCAGGCGTACGAAGGTGGCGCATCGTCGTCGACCCGGGCATCGGC
TTCGCCAAGACGGCGGAGCAGAACATGCAGCTGCTGGCCAGGCTGGAAGAGCTCAGACGGTCCAGGGGGCTCGAG
GGATTGCCGTGGCTGGTGGGAGTCAGCCGGAAGGGCTTCGTCGGCCGGGTGACGGGTGCGTCTGACCGGGTTTGG
GGCACGGCTGCGGCGGTGGCTGCGGCGGTCGGGGGGGGTGCGGATGTGGTGAGGGTGCATGATGTGTGTGAGATG
TCTGCGGTTGCGGCCATGGCGGATGCCATCTGGAGAGGGGTGGTGAAGGGTGGCTGA
Transcript >Ophcf2|04065
ATGAGCCCGTCCCTCCTCCGGGTCCGGTCTCCGTGGACGCTCCTCGGCAGCCGCTCAGCCTCGACAAAGGCCTAC
ATCGCGCTGGGCAGCAACGTGGGCGACCGAATCGCAGCCATCGAGACGGCCTGTCGCGAGATGGACCGTCGCGGC
ATGCGCGTCAGGCGTACCAGCAGCCTGTGGGAGACGCCGCCCATGTACGTGACGGATCAAGGACGGTTCATCAAC
GGCGCCTGCGAGATCGAGACGGACTTGGGTCCTTTTGCTTTGCTGGATGAGCTTCAGCGGATTGAGAGGGACATG
GGACGCCGGAAGGTGGTTGATAAGGGTCCTCGCAACATTGATCTCGACATTCTCTTGTATGGAGATGTTTCGATT
TCCGACCAGCGACTTACGGTGCCTCATGCTGGGATAGCCGAGCGCGAGTTTGTCCTGCGGCCTCTCGCCCAGCTG
ATGGCTCGTCAGCCGCTGTTCGCATCGCGGCCGCAGAAGCTGGTGCAGGATTACCTCGACGAGCTGCCACCTGGC
GAGGCGCTTTCCACAGTGACGCCACTGGCGGCCCGAGGCGGCTTCCTCAGGCCGAACCGCGAGACGCACGTCATG
GCGATTGTGAACCTCACGCCCGACTCCTTCTCGGACGGGGGCCGTCACAACATGAGCAACCTGGCGAGCACCGTG
GTCGAAATGCTACGCGGGGGAGCCACCATGATCGACGTCGGCGGACAATCGACAGCGCCCGGACGACGGGCCGTG
ACGGCGGAAGAGGAGGCGTCGCGGGTGGTGCCGGCCATTGAGCTCATACGATCGCTCCCCGAGGCGCGCGATGCC
GTCATCAGCGTCGACACGTATCGAGCCTCGGTGGCCGAGAAGGCGGTGGCCAGCGGAGCCGACATGGTCAACGAC
GTCTCGGCCGGCACGCTGGACGCGGACATGCTCCCGACGGTAGCCAGGCTGGGGAAGACCATCTGCCTGATGCAC
ATGCGCGGCACACCGCAGACGATGATGTCGCAGACGGCCTACCCGAACGGCCTCATCCCCACGACGGCATCGGAG
CTCGAGGCGCGGGTGGCGGCGGCGCAAGAGGCAGGCGTACGAAGGTGGCGCATCGTCGTCGACCCGGGCATCGGC
TTCGCCAAGACGGCGGAGCAGAACATGCAGCTGCTGGCCAGGCTGGAAGAGCTCAGACGGTCCAGGGGGCTCGAG
GGATTGCCGTGGCTGGTGGGAGTCAGCCGGAAGGGCTTCGTCGGCCGGGTGACGGGTGCGTCTGACCGGGTTTGG
GGCACGGCTGCGGCGGTGGCTGCGGCGGTCGGGGGGGGTGCGGATGTGGTGAGGGTGCATGATGTGTGTGAGATG
TCTGCGGTTGCGGCCATGGCGGATGCCATCTGGAGAGGGGTGGTGAAGGGTGGCTGA
Gene >Ophcf2|04065
ATGAGCCCGTCCCTCCTCCGGGTCCGGTCTCCGTGGACGCTCCTCGGCAGCCGCTCAGCCTCGACAAAGGCCTAC
ATCGCGCTGGGCAGCAACGTGGGCGACCGAATCGCAGCCATCGAGACGGCCTGTCGCGAGATGGACCGTCGCGGC
ATGCGCGTCAGGCGTACCAGCAGCCTGTGGGAGACGCCGCCCATGTACGTGACGGATCAAGGACGGTTCATCAAC
GGCGCCTGCGAGGTCTTTGCTTCCTTTGCTTGCATGTCGTCGGCTCGGCCCGGCTGACCCAGGGCTAGATCGAGA
CGGACTTGGGTCCTTTTGCTTTGCTGGATGAGCTTCAGCGGATTGAGAGGGACATGGGACGCCGGAAGGTGGTTG
ATAAGGGTCCTCGCAACATTGATCTCGACATTCTCTTGTATGGAGATGTTTCGATTTCCGACCAGCGACTTACGG
TGCCTCATGCTGGGATAGCCGAGCGCGAGTTTGTCCTGCGGCCTCTCGCCCAGTCAGTGACGGCCGATTCCTCTC
GATTCCGTTCTTGTCTCGCCTCGTCTTACCGTTTCGTCAGGGCAGGCTGATGGCTCGTCAGCCGCTGTTCGCATC
GCGGCCGCAGAAGCTGGTGCAGGATTACCTCGACGAGCTGCCACCTGGCGAGGCGCTTTCCACAGTGACGCCACT
GGCGGCCCGAGGCGGCTTCCTCAGGCCGAACCGCGAGACGCACGTCATGGCGATTGTGAACCTCACGCCCGACTC
CTTCTCGGACGGGGGCCGTCACAACATGAGCAACCTGGCGAGCACCGTGGTCGAAATGCTACGCGGGGGAGCCAC
CATGATCGACGTCGGCGGACAATCGACAGCGCCCGGACGACGGGCCGTGACGGCGGAAGAGGAGGCGTCGCGGGT
GGTGCCGGCCATTGAGCTCATACGATCGCTCCCCGAGGCGCGCGATGCCGTCATCAGCGTCGACACGTATCGAGC
CTCGGTGGCCGAGAAGGCGGTGGCCAGCGGAGCCGACATGGTCAACGACGTCTCGGCCGGCACGCTGGACGCGGA
CATGCTCCCGACGGTAGCCAGGCTGGGGAAGACCATCTGCCTGATGCACATGCGCGGCACACCGCAGACGATGAT
GTCGCAGACGGCCTACCCGAACGGCCTCATCCCCACGACGGCATCGGAGCTCGAGGCGCGGGTGGCGGCGGCGCA
AGAGGCAGGCGTACGAAGGTGGCGCATCGTCGTCGACCCGGGCATCGGCTTCGCCAAGACGGCGGAGCAGAACAT
GCAGCTGCTGGCCAGGCTGGAAGAGCTCAGACGGTCCAGGGGGCTCGAGGGATTGCCGTGGCTGGTGGGAGTCAG
CCGGAAGGGCTTCGTCGGCCGGGTGACGGGTGCGTCTGACCGGGTTTGGGGCACGGCTGCGGCGGTGGCTGCGGC
GGTCGGGGGGGGTGCGGATGTGGTGAGGGTGCATGATGTGTGTGAGATGTCTGCGGTTGCGGCCATGGCGGATGC
CATCTGGAGAGGGGTGGTGAAGGGTGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail