Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04060
Gene name
Locationscaffold_04:744440..745775
Strand+
Gene length (bp)1335
Transcript length (bp)1335
Coding sequence length (bp)1335
Protein length (aa) 445

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00781 DAGK_cat Diacylglycerol kinase catalytic domain 7.5E-09 102 210

GO

GO Term Description Terminal node
GO:0016301 kinase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016740 transferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.7262 0.6716 0.243 0.0782 0.1949 0.0042 0.2661 0.3966 0.4309 0.0405

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1399
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5823
Ophiocordyceps australis map64 (Brazil) OphauB2|1273
Ophiocordyceps camponoti-floridani Ophcf2|04060 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2149
Ophiocordyceps kimflemingae Ophio5|2292
Ophiocordyceps subramaniannii Hirsu2|10883

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04060
MDSTDESLQSLQPLPVHSVGFRNESLVYTLSDGTQDAVTADEVLFALDLTPSARGFIVCCLREGVDTQCNLLLLT
TDALPAELQPIISQLPRHLCRKDGSQVHIIVSTHSGTGLAPTFWRTVLRPLLHLVCDMFGARPPDEALMTDGVRA
VRDFGVRLRGGRGEQTVILLSGDGGVADLLDGYGVEEADTKPTIALLPLGTGNALFHSLHRLSPDDDGSAGSSPL
AKGLRTLFLGEAAGLPIFRASFSPGSRLATSSDDDDDDDESKPVSYIHGAIVASFAFHASLIHESDTRQYRLHGA
QRFSLVAENLLQQPHAYRAEVTTDGETLPHDEHGYLVIAMTSNLERTFTISPASRPLDGRLHLVRLGDLAADRVV
QVMQRAYAGGSHVGLAWDDGEAVLYREVADVRVRLWDESERWRKVCVDGTIVLVPRGGEVRVWGLGVRP*
Coding >Ophcf2|04060
ATGGACTCTACGGACGAGAGCCTCCAGAGCCTCCAGCCGCTACCAGTCCACAGCGTCGGCTTCCGAAACGAAAGC
CTGGTTTATACGCTGAGTGATGGCACCCAAGACGCCGTCACAGCCGACGAGGTCCTCTTCGCCCTGGACCTCACA
CCGTCGGCACGGGGCTTCATCGTCTGCTGTCTGCGAGAGGGCGTCGACACCCAATGTAACCTTCTGCTCCTCACA
ACCGACGCGTTACCAGCCGAGCTGCAGCCCATCATCAGTCAGCTTCCGCGACATCTCTGCCGCAAAGATGGAAGC
CAGGTTCACATCATCGTATCGACGCATTCGGGCACCGGGCTGGCTCCGACCTTTTGGCGGACGGTGCTGCGTCCG
CTGCTGCATCTCGTCTGCGACATGTTCGGCGCCCGACCGCCTGATGAGGCTTTAATGACGGATGGGGTGAGAGCC
GTGAGGGACTTTGGTGTTCGATTGAGAGGTGGACGAGGCGAGCAGACCGTCATCTTACTCAGTGGCGACGGAGGC
GTTGCGGATCTGCTGGACGGATATGGCGTCGAAGAAGCCGATACGAAGCCAACGATTGCCCTTTTACCGCTCGGG
ACCGGCAACGCGCTATTCCACTCTCTTCATCGGCTCTCCCCCGACGATGACGGATCAGCCGGATCATCGCCTCTG
GCAAAGGGCTTACGGACGCTCTTCCTAGGCGAAGCAGCCGGGTTACCCATCTTCCGCGCCAGCTTCTCACCCGGA
TCTCGCCTCGCCACGTCTTCCGACGATGATGATGATGATGATGAATCGAAGCCCGTCTCTTACATACACGGCGCC
ATCGTCGCCAGCTTCGCTTTCCACGCAAGCCTCATCCACGAAAGCGACACGCGACAATACCGCCTCCACGGCGCA
CAGCGCTTCTCCCTCGTCGCCGAGAACCTCCTCCAGCAGCCGCACGCGTACCGAGCAGAAGTGACGACAGACGGC
GAGACGCTCCCTCACGACGAACACGGCTACCTCGTCATAGCAATGACCTCCAACCTGGAGCGCACATTCACCATC
TCGCCCGCAAGCAGGCCCCTCGACGGAAGACTTCACCTGGTGCGCCTGGGAGACTTGGCCGCTGATCGCGTCGTG
CAGGTCATGCAGAGGGCGTACGCGGGCGGATCGCACGTCGGCTTGGCGTGGGATGATGGCGAGGCCGTTTTGTAT
CGTGAGGTGGCCGACGTGCGGGTTAGGTTGTGGGATGAGTCGGAGAGGTGGCGTAAGGTTTGTGTGGATGGGACG
ATTGTCTTGGTTCCGAGGGGGGGGGAGGTGAGGGTTTGGGGGTTGGGGGTGAGGCCCTGA
Transcript >Ophcf2|04060
ATGGACTCTACGGACGAGAGCCTCCAGAGCCTCCAGCCGCTACCAGTCCACAGCGTCGGCTTCCGAAACGAAAGC
CTGGTTTATACGCTGAGTGATGGCACCCAAGACGCCGTCACAGCCGACGAGGTCCTCTTCGCCCTGGACCTCACA
CCGTCGGCACGGGGCTTCATCGTCTGCTGTCTGCGAGAGGGCGTCGACACCCAATGTAACCTTCTGCTCCTCACA
ACCGACGCGTTACCAGCCGAGCTGCAGCCCATCATCAGTCAGCTTCCGCGACATCTCTGCCGCAAAGATGGAAGC
CAGGTTCACATCATCGTATCGACGCATTCGGGCACCGGGCTGGCTCCGACCTTTTGGCGGACGGTGCTGCGTCCG
CTGCTGCATCTCGTCTGCGACATGTTCGGCGCCCGACCGCCTGATGAGGCTTTAATGACGGATGGGGTGAGAGCC
GTGAGGGACTTTGGTGTTCGATTGAGAGGTGGACGAGGCGAGCAGACCGTCATCTTACTCAGTGGCGACGGAGGC
GTTGCGGATCTGCTGGACGGATATGGCGTCGAAGAAGCCGATACGAAGCCAACGATTGCCCTTTTACCGCTCGGG
ACCGGCAACGCGCTATTCCACTCTCTTCATCGGCTCTCCCCCGACGATGACGGATCAGCCGGATCATCGCCTCTG
GCAAAGGGCTTACGGACGCTCTTCCTAGGCGAAGCAGCCGGGTTACCCATCTTCCGCGCCAGCTTCTCACCCGGA
TCTCGCCTCGCCACGTCTTCCGACGATGATGATGATGATGATGAATCGAAGCCCGTCTCTTACATACACGGCGCC
ATCGTCGCCAGCTTCGCTTTCCACGCAAGCCTCATCCACGAAAGCGACACGCGACAATACCGCCTCCACGGCGCA
CAGCGCTTCTCCCTCGTCGCCGAGAACCTCCTCCAGCAGCCGCACGCGTACCGAGCAGAAGTGACGACAGACGGC
GAGACGCTCCCTCACGACGAACACGGCTACCTCGTCATAGCAATGACCTCCAACCTGGAGCGCACATTCACCATC
TCGCCCGCAAGCAGGCCCCTCGACGGAAGACTTCACCTGGTGCGCCTGGGAGACTTGGCCGCTGATCGCGTCGTG
CAGGTCATGCAGAGGGCGTACGCGGGCGGATCGCACGTCGGCTTGGCGTGGGATGATGGCGAGGCCGTTTTGTAT
CGTGAGGTGGCCGACGTGCGGGTTAGGTTGTGGGATGAGTCGGAGAGGTGGCGTAAGGTTTGTGTGGATGGGACG
ATTGTCTTGGTTCCGAGGGGGGGGGAGGTGAGGGTTTGGGGGTTGGGGGTGAGGCCCTGA
Gene >Ophcf2|04060
ATGGACTCTACGGACGAGAGCCTCCAGAGCCTCCAGCCGCTACCAGTCCACAGCGTCGGCTTCCGAAACGAAAGC
CTGGTTTATACGCTGAGTGATGGCACCCAAGACGCCGTCACAGCCGACGAGGTCCTCTTCGCCCTGGACCTCACA
CCGTCGGCACGGGGCTTCATCGTCTGCTGTCTGCGAGAGGGCGTCGACACCCAATGTAACCTTCTGCTCCTCACA
ACCGACGCGTTACCAGCCGAGCTGCAGCCCATCATCAGTCAGCTTCCGCGACATCTCTGCCGCAAAGATGGAAGC
CAGGTTCACATCATCGTATCGACGCATTCGGGCACCGGGCTGGCTCCGACCTTTTGGCGGACGGTGCTGCGTCCG
CTGCTGCATCTCGTCTGCGACATGTTCGGCGCCCGACCGCCTGATGAGGCTTTAATGACGGATGGGGTGAGAGCC
GTGAGGGACTTTGGTGTTCGATTGAGAGGTGGACGAGGCGAGCAGACCGTCATCTTACTCAGTGGCGACGGAGGC
GTTGCGGATCTGCTGGACGGATATGGCGTCGAAGAAGCCGATACGAAGCCAACGATTGCCCTTTTACCGCTCGGG
ACCGGCAACGCGCTATTCCACTCTCTTCATCGGCTCTCCCCCGACGATGACGGATCAGCCGGATCATCGCCTCTG
GCAAAGGGCTTACGGACGCTCTTCCTAGGCGAAGCAGCCGGGTTACCCATCTTCCGCGCCAGCTTCTCACCCGGA
TCTCGCCTCGCCACGTCTTCCGACGATGATGATGATGATGATGAATCGAAGCCCGTCTCTTACATACACGGCGCC
ATCGTCGCCAGCTTCGCTTTCCACGCAAGCCTCATCCACGAAAGCGACACGCGACAATACCGCCTCCACGGCGCA
CAGCGCTTCTCCCTCGTCGCCGAGAACCTCCTCCAGCAGCCGCACGCGTACCGAGCAGAAGTGACGACAGACGGC
GAGACGCTCCCTCACGACGAACACGGCTACCTCGTCATAGCAATGACCTCCAACCTGGAGCGCACATTCACCATC
TCGCCCGCAAGCAGGCCCCTCGACGGAAGACTTCACCTGGTGCGCCTGGGAGACTTGGCCGCTGATCGCGTCGTG
CAGGTCATGCAGAGGGCGTACGCGGGCGGATCGCACGTCGGCTTGGCGTGGGATGATGGCGAGGCCGTTTTGTAT
CGTGAGGTGGCCGACGTGCGGGTTAGGTTGTGGGATGAGTCGGAGAGGTGGCGTAAGGTTTGTGTGGATGGGACG
ATTGTCTTGGTTCCGAGGGGGGGGGAGGTGAGGGTTTGGGGGTTGGGGGTGAGGCCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail