Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04051
Gene name
Locationscaffold_04:719615..723160
Strand+
Gene length (bp)3545
Transcript length (bp)3483
Coding sequence length (bp)3483
Protein length (aa) 1161

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13515 FUSC_2 Fusaric acid resistance protein-like 6.5E-12 702 832
PF10337 ArAE_2_N Putative ER transporter, 6TM, N-terminal 2.0E-10 147 420
PF11744 ALMT Aluminium activated malate transporter 6.8E-05 689 856

GO

GO Term Description Terminal node
GO:0015743 malate transport Yes
GO:0015740 C4-dicarboxylate transport No
GO:0051179 localization No
GO:0006835 dicarboxylic acid transport No
GO:0015711 organic anion transport No
GO:0015849 organic acid transport No
GO:0071702 organic substance transport No
GO:0008150 biological_process No
GO:0006811 ion transport No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0006820 anion transport No
GO:0046942 carboxylic acid transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

Domain # Start End Length
1 71 93 22
2 113 135 22
3 142 164 22
4 174 196 22
5 201 223 22
6 728 750 22
7 763 785 22
8 790 812 22
9 819 841 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04051
MRSSLLETPLRTEYQQKETSNPSPLLLQTIPFVHRNGIGSDLASVMASSNVLHSFVAFLWGRRQENALWQALLKY
AIAIAFALALAFLPAFRIASTFLIPMIVAFAHPGQRMGLMIQSLLMVLFGAGIGLSWSLLGLRLALLVGNNTAAA
STIRALFLLVLILVHGYLRSSNPRLMLFVTFLLITAVVTVQLPITVTGIIFTTAYIPLLVGAGLLLIVNLAIFPE
LSSSYLGSTTIDTLSETVDTLTRATNWFVTPGGDPDTVSAEMVHSKNEPSMSVKSGAVAKFLSQFPNPFRSAKHG
SALSSTPHHSTNLSALTEQKPKLRACLARCKAVQNEVNFEISFSPLPPTALKPISIQYMTGLVRNVTTLIGACEN
KFVVVGKNEQSDEKNGANGKRDKTAGKKSGPKASRRVSRANHFPSVKPIKEIETSSAELLEAILTRIRGPAQVFQ
VSVAEAANLVILCLAYCFDVPRLPSGAAAPRTVSLQELDVRIDKFARSLTLFDTEAANQLRENMMDKSYEPVDFM
PGMETFMVSSFILSLRDSAAQLLEMLRHLRLLVESRQRHNDHSRLWVPQLTIFRQWLAKRKPTRAAEPAEVPSII
QTPVEGHVPGPIPAVDRPDARHTPYEEGRIGQTVQWAELKSPRKIKSSKKRARRKSELQNLDWMAKTREKAADAL
EWAQKSNDLDYALKLAVAMFLLLWPAFFASWRPWYTQVRGIWAPMQLMLVFEVCIGSSAFGFFLRLIGVVYGCVA
GFAAYEIGRGNRVAVAVALFLVMMPSIYLHLVAPQYAKVAIVSIVSMSVVALASINGTVPAYEIFYKRLVAFLVG
GIVAMLVEVVIAPVRARDRLVECLSYSVRQIQKMEMTLAVGIEGPWSPNIRSQALLSRFNRARDKAHGALADAES
ALPFCLREPRLKGSFKPLAPIYTEITYVLHQIIDRMDNLVQLRRTYGSSILEDLNPKVYAYRRNVAASTTLMLFS
VNEALTNWLPLPQFLPSARLALIRLISRVREIVASDNTSPSPRTELDEETATLITKRKFLSWNAGAVGQIEIVEY
LEELIELVKLLVGVNGFRGGMLEQSSFGAEVLVQTARTPEPEPGESGGGWSPVRWTATTVEAIDECETGSEGGSW
DEGIPLSLQRVGTRLRRGSSVVRRRTASSAGIGIR*
Coding >Ophcf2|04051
ATGCGCTCTTCATTGCTCGAGACACCGCTTCGGACCGAGTATCAGCAAAAGGAAACCTCCAACCCGTCGCCGCTT
CTTCTTCAAACCATCCCCTTCGTCCACCGCAATGGTATCGGATCCGATCTCGCGTCCGTCATGGCGTCTTCAAAT
GTGCTGCACAGCTTCGTCGCCTTTCTCTGGGGCCGTCGTCAGGAGAATGCCTTGTGGCAGGCTTTGCTCAAGTAT
GCCATCGCCATTGCATTCGCTCTCGCCCTGGCCTTTCTCCCTGCCTTTCGAATCGCCTCGACCTTCCTGATACCC
ATGATCGTCGCCTTTGCACATCCCGGCCAGAGGATGGGCTTGATGATCCAATCGCTGCTCATGGTGCTTTTCGGC
GCCGGTATCGGTCTGTCTTGGTCTCTTTTGGGTCTTCGACTAGCCTTACTCGTCGGGAATAACACAGCCGCCGCG
AGCACCATCCGAGCTCTTTTTCTGCTCGTTCTCATTCTCGTTCACGGCTATTTGCGATCTTCAAATCCTCGACTC
ATGCTCTTCGTCACCTTTCTTCTCATCACGGCCGTCGTGACCGTTCAGCTGCCCATCACCGTCACGGGCATCATC
TTCACCACAGCATACATTCCCTTACTTGTGGGCGCTGGTTTGCTGCTCATCGTCAACCTCGCAATCTTCCCGGAA
CTATCCAGCTCCTACTTGGGCTCTACGACCATCGATACGCTGTCGGAGACGGTCGACACATTGACGCGGGCAACT
AATTGGTTCGTCACCCCCGGCGGTGACCCGGACACTGTCTCGGCCGAGATGGTACACTCCAAAAACGAACCCTCC
ATGTCTGTCAAATCGGGAGCCGTTGCCAAGTTCTTGTCACAGTTTCCCAATCCCTTTCGTTCGGCCAAGCACGGG
TCTGCTCTGTCCTCGACGCCCCATCACTCTACTAATCTTTCTGCTCTGACGGAGCAGAAGCCGAAGCTGCGTGCG
TGCCTCGCACGCTGCAAAGCGGTTCAGAACGAGGTCAACTTTGAGATATCCTTTTCGCCTCTACCACCAACTGCT
CTGAAGCCCATCAGCATTCAGTACATGACTGGTCTGGTTCGAAACGTAACTACCCTGATTGGCGCTTGCGAGAAC
AAATTCGTCGTTGTGGGCAAGAATGAGCAATCGGACGAGAAGAACGGAGCAAATGGAAAAAGAGACAAGACAGCA
GGCAAGAAATCAGGCCCCAAGGCTTCGAGAAGAGTGTCCCGCGCGAACCACTTCCCGAGCGTGAAGCCGATTAAA
GAAATCGAGACGAGCAGTGCTGAACTGCTGGAAGCAATCCTCACACGCATTCGAGGTCCCGCTCAGGTTTTCCAA
GTGTCCGTGGCTGAGGCTGCCAATCTCGTCATCCTGTGTCTCGCCTATTGCTTCGACGTACCGAGGCTTCCTTCA
GGGGCCGCAGCCCCCAGGACCGTGTCTCTGCAGGAGCTTGACGTTAGAATCGACAAGTTTGCCCGCTCGCTGACT
CTGTTCGACACCGAGGCCGCCAATCAGCTCAGAGAGAACATGATGGACAAGTCGTATGAGCCGGTCGACTTTATG
CCCGGCATGGAGACTTTCATGGTATCTTCCTTCATCTTGTCTCTTCGGGACTCTGCGGCGCAACTGTTGGAAATG
CTCCGCCATTTGCGGCTTCTCGTCGAGAGCAGACAGCGTCACAACGACCACTCCAGACTCTGGGTGCCGCAATTG
ACGATATTCCGCCAGTGGCTCGCGAAGCGGAAGCCAACTAGGGCAGCGGAACCCGCCGAGGTGCCCAGCATCATC
CAGACCCCAGTCGAAGGCCATGTCCCAGGGCCGATACCAGCCGTTGACCGTCCAGACGCCCGTCACACTCCGTAC
GAAGAGGGTCGAATTGGTCAAACGGTGCAATGGGCGGAACTAAAGTCACCGAGAAAGATCAAGTCATCGAAAAAG
CGAGCCCGTCGAAAGTCGGAACTCCAGAATCTCGACTGGATGGCCAAGACGAGGGAGAAGGCTGCTGACGCTCTT
GAATGGGCGCAAAAGTCCAATGATCTGGACTACGCCCTCAAGCTGGCCGTCGCCATGTTCCTTCTCCTCTGGCCC
GCCTTTTTCGCGTCATGGCGGCCGTGGTATACGCAGGTTCGTGGCATCTGGGCGCCCATGCAATTGATGCTGGTC
TTTGAGGTTTGCATCGGCAGCTCGGCCTTTGGTTTCTTCCTTCGTCTTATCGGCGTTGTCTACGGATGTGTTGCT
GGATTTGCGGCGTATGAGATTGGGAGAGGTAACCGAGTTGCCGTTGCCGTCGCTCTTTTCCTTGTCATGATGCCG
AGCATCTACCTTCATCTCGTCGCTCCCCAGTATGCCAAGGTGGCTATCGTCTCCATCGTGTCCATGTCCGTTGTC
GCCCTCGCCTCGATCAATGGCACCGTCCCCGCCTACGAGATCTTCTACAAACGTCTCGTAGCCTTCCTCGTCGGT
GGCATCGTCGCTATGCTAGTCGAGGTCGTCATTGCCCCTGTGCGGGCCCGAGACCGACTAGTCGAGTGTCTTTCC
TATTCAGTGCGGCAAATCCAGAAGATGGAAATGACTCTCGCTGTCGGCATCGAAGGGCCTTGGAGTCCAAACATC
CGTTCGCAAGCTCTACTCTCCCGCTTCAACCGCGCCCGCGACAAGGCACACGGGGCCCTAGCCGATGCCGAATCG
GCACTTCCCTTCTGCCTCAGAGAGCCGCGTCTAAAGGGGAGCTTCAAGCCGCTGGCGCCCATCTACACGGAAATC
ACCTACGTCCTCCACCAGATCATCGACAGGATGGACAATCTCGTTCAGCTACGGAGAACGTACGGCTCCTCCATC
CTCGAAGACCTGAACCCAAAGGTGTACGCCTACAGGAGGAACGTGGCGGCCAGCACGACACTGATGCTCTTCTCC
GTCAACGAGGCGCTCACCAACTGGCTACCCCTCCCACAGTTCTTGCCCTCAGCCCGCCTCGCCCTCATCCGCCTC
ATCAGCCGCGTCCGCGAAATCGTAGCCTCAGACAACACATCGCCCAGCCCCCGCACCGAACTAGACGAAGAGACG
GCAACCCTCATCACCAAACGCAAGTTCCTATCCTGGAACGCCGGCGCCGTCGGCCAAATCGAAATCGTGGAATAC
CTCGAAGAACTCATCGAGCTCGTCAAGCTCCTCGTCGGCGTCAACGGCTTCCGAGGCGGCATGCTGGAGCAGTCG
TCGTTCGGTGCAGAGGTGCTGGTACAGACGGCGCGCACACCGGAGCCGGAGCCCGGTGAAAGCGGTGGTGGCTGG
TCTCCGGTGCGCTGGACGGCGACGACGGTGGAGGCCATTGATGAGTGCGAGACGGGTTCCGAAGGCGGGAGTTGG
GATGAGGGCATTCCGCTTAGCTTGCAGAGGGTTGGGACTCGGTTGAGGAGGGGGAGTTCTGTGGTGAGAAGGAGG
ACGGCGTCTTCGGCTGGGATCGGGATTCGATGA
Transcript >Ophcf2|04051
ATGCGCTCTTCATTGCTCGAGACACCGCTTCGGACCGAGTATCAGCAAAAGGAAACCTCCAACCCGTCGCCGCTT
CTTCTTCAAACCATCCCCTTCGTCCACCGCAATGGTATCGGATCCGATCTCGCGTCCGTCATGGCGTCTTCAAAT
GTGCTGCACAGCTTCGTCGCCTTTCTCTGGGGCCGTCGTCAGGAGAATGCCTTGTGGCAGGCTTTGCTCAAGTAT
GCCATCGCCATTGCATTCGCTCTCGCCCTGGCCTTTCTCCCTGCCTTTCGAATCGCCTCGACCTTCCTGATACCC
ATGATCGTCGCCTTTGCACATCCCGGCCAGAGGATGGGCTTGATGATCCAATCGCTGCTCATGGTGCTTTTCGGC
GCCGGTATCGGTCTGTCTTGGTCTCTTTTGGGTCTTCGACTAGCCTTACTCGTCGGGAATAACACAGCCGCCGCG
AGCACCATCCGAGCTCTTTTTCTGCTCGTTCTCATTCTCGTTCACGGCTATTTGCGATCTTCAAATCCTCGACTC
ATGCTCTTCGTCACCTTTCTTCTCATCACGGCCGTCGTGACCGTTCAGCTGCCCATCACCGTCACGGGCATCATC
TTCACCACAGCATACATTCCCTTACTTGTGGGCGCTGGTTTGCTGCTCATCGTCAACCTCGCAATCTTCCCGGAA
CTATCCAGCTCCTACTTGGGCTCTACGACCATCGATACGCTGTCGGAGACGGTCGACACATTGACGCGGGCAACT
AATTGGTTCGTCACCCCCGGCGGTGACCCGGACACTGTCTCGGCCGAGATGGTACACTCCAAAAACGAACCCTCC
ATGTCTGTCAAATCGGGAGCCGTTGCCAAGTTCTTGTCACAGTTTCCCAATCCCTTTCGTTCGGCCAAGCACGGG
TCTGCTCTGTCCTCGACGCCCCATCACTCTACTAATCTTTCTGCTCTGACGGAGCAGAAGCCGAAGCTGCGTGCG
TGCCTCGCACGCTGCAAAGCGGTTCAGAACGAGGTCAACTTTGAGATATCCTTTTCGCCTCTACCACCAACTGCT
CTGAAGCCCATCAGCATTCAGTACATGACTGGTCTGGTTCGAAACGTAACTACCCTGATTGGCGCTTGCGAGAAC
AAATTCGTCGTTGTGGGCAAGAATGAGCAATCGGACGAGAAGAACGGAGCAAATGGAAAAAGAGACAAGACAGCA
GGCAAGAAATCAGGCCCCAAGGCTTCGAGAAGAGTGTCCCGCGCGAACCACTTCCCGAGCGTGAAGCCGATTAAA
GAAATCGAGACGAGCAGTGCTGAACTGCTGGAAGCAATCCTCACACGCATTCGAGGTCCCGCTCAGGTTTTCCAA
GTGTCCGTGGCTGAGGCTGCCAATCTCGTCATCCTGTGTCTCGCCTATTGCTTCGACGTACCGAGGCTTCCTTCA
GGGGCCGCAGCCCCCAGGACCGTGTCTCTGCAGGAGCTTGACGTTAGAATCGACAAGTTTGCCCGCTCGCTGACT
CTGTTCGACACCGAGGCCGCCAATCAGCTCAGAGAGAACATGATGGACAAGTCGTATGAGCCGGTCGACTTTATG
CCCGGCATGGAGACTTTCATGGTATCTTCCTTCATCTTGTCTCTTCGGGACTCTGCGGCGCAACTGTTGGAAATG
CTCCGCCATTTGCGGCTTCTCGTCGAGAGCAGACAGCGTCACAACGACCACTCCAGACTCTGGGTGCCGCAATTG
ACGATATTCCGCCAGTGGCTCGCGAAGCGGAAGCCAACTAGGGCAGCGGAACCCGCCGAGGTGCCCAGCATCATC
CAGACCCCAGTCGAAGGCCATGTCCCAGGGCCGATACCAGCCGTTGACCGTCCAGACGCCCGTCACACTCCGTAC
GAAGAGGGTCGAATTGGTCAAACGGTGCAATGGGCGGAACTAAAGTCACCGAGAAAGATCAAGTCATCGAAAAAG
CGAGCCCGTCGAAAGTCGGAACTCCAGAATCTCGACTGGATGGCCAAGACGAGGGAGAAGGCTGCTGACGCTCTT
GAATGGGCGCAAAAGTCCAATGATCTGGACTACGCCCTCAAGCTGGCCGTCGCCATGTTCCTTCTCCTCTGGCCC
GCCTTTTTCGCGTCATGGCGGCCGTGGTATACGCAGGTTCGTGGCATCTGGGCGCCCATGCAATTGATGCTGGTC
TTTGAGGTTTGCATCGGCAGCTCGGCCTTTGGTTTCTTCCTTCGTCTTATCGGCGTTGTCTACGGATGTGTTGCT
GGATTTGCGGCGTATGAGATTGGGAGAGGTAACCGAGTTGCCGTTGCCGTCGCTCTTTTCCTTGTCATGATGCCG
AGCATCTACCTTCATCTCGTCGCTCCCCAGTATGCCAAGGTGGCTATCGTCTCCATCGTGTCCATGTCCGTTGTC
GCCCTCGCCTCGATCAATGGCACCGTCCCCGCCTACGAGATCTTCTACAAACGTCTCGTAGCCTTCCTCGTCGGT
GGCATCGTCGCTATGCTAGTCGAGGTCGTCATTGCCCCTGTGCGGGCCCGAGACCGACTAGTCGAGTGTCTTTCC
TATTCAGTGCGGCAAATCCAGAAGATGGAAATGACTCTCGCTGTCGGCATCGAAGGGCCTTGGAGTCCAAACATC
CGTTCGCAAGCTCTACTCTCCCGCTTCAACCGCGCCCGCGACAAGGCACACGGGGCCCTAGCCGATGCCGAATCG
GCACTTCCCTTCTGCCTCAGAGAGCCGCGTCTAAAGGGGAGCTTCAAGCCGCTGGCGCCCATCTACACGGAAATC
ACCTACGTCCTCCACCAGATCATCGACAGGATGGACAATCTCGTTCAGCTACGGAGAACGTACGGCTCCTCCATC
CTCGAAGACCTGAACCCAAAGGTGTACGCCTACAGGAGGAACGTGGCGGCCAGCACGACACTGATGCTCTTCTCC
GTCAACGAGGCGCTCACCAACTGGCTACCCCTCCCACAGTTCTTGCCCTCAGCCCGCCTCGCCCTCATCCGCCTC
ATCAGCCGCGTCCGCGAAATCGTAGCCTCAGACAACACATCGCCCAGCCCCCGCACCGAACTAGACGAAGAGACG
GCAACCCTCATCACCAAACGCAAGTTCCTATCCTGGAACGCCGGCGCCGTCGGCCAAATCGAAATCGTGGAATAC
CTCGAAGAACTCATCGAGCTCGTCAAGCTCCTCGTCGGCGTCAACGGCTTCCGAGGCGGCATGCTGGAGCAGTCG
TCGTTCGGTGCAGAGGTGCTGGTACAGACGGCGCGCACACCGGAGCCGGAGCCCGGTGAAAGCGGTGGTGGCTGG
TCTCCGGTGCGCTGGACGGCGACGACGGTGGAGGCCATTGATGAGTGCGAGACGGGTTCCGAAGGCGGGAGTTGG
GATGAGGGCATTCCGCTTAGCTTGCAGAGGGTTGGGACTCGGTTGAGGAGGGGGAGTTCTGTGGTGAGAAGGAGG
ACGGCGTCTTCGGCTGGGATCGGGATTCGATGA
Gene >Ophcf2|04051
ATGCGCTCTTCATTGCTCGAGACACCGCTTCGGACCGAGTATCAGCAAAAGGAAACCTCCAACCCGTCGCCGCTT
CTTCTTCAAACCATCCCCTTCGTCCACCGCAATGGTATCGGATCCGATCTCGCGTCCGTCATGGCGTCTTCAAAT
GTGCTGCACAGCTTCGTCGCCTTTCTCTGGGGCCGTCGTCAGGAGAATGCCTTGTGGCAGGCTTTGCTCAAGTAT
GCCATCGCCATTGCATTCGCTCTCGCCCTGGCCTTTCTCCCTGCCTTTCGAATCGCCTCGACCTTCCTGATACCC
ATGATCGTCGCCTTTGCACATCCCGGCCAGAGGATGGGCTTGATGATCCAATCGCTGCTCATGGTGCTTTTCGGC
GCCGGTATCGGTCTGTCTTGGTCTCTTTTGGGTCTTCGACTAGCCTTACTCGTCGGGAATAACACAGCCGCCGCG
AGCACCATCCGAGCTCTTTTTCTGCTCGTTCTCATTCTCGTTCACGGCTATTTGCGATCTTCAAATCCTCGACTC
ATGCTCTTCGTCACCTTTCTTCTCATCACGGCCGTCGTGACCGTTCAGCTGCCCATCACCGTCACGGGCATCATC
TTCACCACAGCATACATTCCCTTACTTGTGGGCGCTGGTTTGCTGCTCATCGTCAACCTCGCAATCTTCCCGGAA
CTATCCAGCTCCTACTTGGGCTCTACGACCATCGATACGCTGTCGGAGACGGTCGACACATTGACGCGGGCAACT
AATTGGTTCGTCACCCCCGGCGGTGACCCGGACACTGTCTCGGCCGAGATGGTACACTCCAAAAACGAACCCTCC
ATGTCTGTCAAATCGGGAGCCGTTGCCAAGTTCTTGTCACAGTTTCCCAATCCCTTTCGTTCGGCCAAGCACGGG
TCTGCTCTGTCCTCGACGCCCCATCACTCTACTAATCTTTCTGCTCTGACGGAGCAGAAGCCGAAGCTGCGTGCG
TGCCTCGCACGCTGCAAAGCGGTTCAGAACGAGGTCAACTTTGAGATATCCTTTTCGCCTCTACCACCAACTGCT
CTGAAGCCCATCAGCATTCAGTACATGACTGGTCTGGTTCGAAACGTAACTACCCTGATTGGCGCTTGCGAGAAC
AAATTCGTCGTTGTGGGCAAGAATGAGCAATCGGACGAGAAGAACGGAGCAAATGGAAAAAGAGACAAGACAGCA
GGCAAGAAATCAGGCCCCAAGGCTTCGAGAAGAGTGTCCCGCGCGAACCACTTCCCGAGCGTGAAGCCGATTAAA
GAAATCGAGACGAGCAGTGCTGAACTGCTGGAAGCAATCCTCACACGCATTCGAGGTCCCGCTCAGGTTTTCCAA
GTGTCCGTGGCTGAGGCTGCCAATCTCGTCATCCTGTGTCTCGCCTATTGCTTCGACGTACCGAGGCTTCCTTCA
GGGGCCGCAGCCCCCAGGACCGTGTCTCTGCAGGAGCTTGACGTTAGAATCGACAAGTTTGCCCGCTCGCTGACT
CTGTTCGACACCGAGGCCGCCAATCAGCTCAGAGAGAACATGATGGACAAGTCGTATGAGCCGGTCGACTTTATG
CCCGGCATGGAGACTTTCATGGTATCTTCCTTCATCTTGTCTCTTCGGGACTCTGCGGCGCAACTGTTGGAAATG
CTCCGCCATTTGCGGCTTCTCGTCGAGAGCAGACAGCGTCACAACGACCACTCCAGACTCTGGGTGCCGCAATTG
ACGATATTCCGCCAGTGGCTCGCGAAGCGGAAGCCAACTAGGGCAGCGGAACCCGCCGAGGTGCCCAGCATCATC
CAGACCCCAGTCGAAGGCCATGTCCCAGGGCCGATACCAGCCGTTGACCGTCCAGACGCCCGTCACACTCCGTAC
GAAGAGGGTCGAATTGGTCAAACGGTGCAATGGGCGGAACTAAAGTCACCGAGAAAGATCAAGTCATCGAAAAAG
CGAGCCCGTCGAAAGTCGGAACTCCAGAATCTCGACTGGATGGCCAAGACGAGGGAGAAGGCTGCTGACGCTCTT
GAATGGGCGCAAAAGTCCAATGATCTGGACTACGCCCTCAAGCTGGCCGTCGCCATGTTCCTTCTCCTCTGGCCC
GCCTTTTTCGCGTCATGGCGGCCGTGGTATACGCAGGTTCGTGGCATCTGGGCGCCCATGCAATTGATGCTGGTC
TTTGAGGTTTGCATCGGCAGCTCGGCCTTTGGTTTCTTCCTTCGTCTTATCGGCGTTGTCTACGGATGTGTTGCT
GGATTTGCGGCGTATGAGATTGGGAGAGGTAACCGAGTTGCCGTTGCCGTCGCTCTTTTCCTTGTCATGATGCCG
AGCATCTACCTTCATCTCGTCGCTCCCCAGTATGCCAAGGTGGCTATCGTCTCCATCGTGTCCATGTCCGTTGTC
GCCCTCGGTAAGTCAGACAATCATCAGCCCGTGGCACGGAATGAAGCTGACGGTCATGTTCCCTACAAGCCTCGA
TCAATGGCACCGTCCCCGCCTACGAGATCTTCTACAAACGTCTCGTAGCCTTCCTCGTCGGTGGCATCGTCGCTA
TGCTAGTCGAGGTCGTCATTGCCCCTGTGCGGGCCCGAGACCGACTAGTCGAGTGTCTTTCCTATTCAGTGCGGC
AAATCCAGAAGATGGAAATGACTCTCGCTGTCGGCATCGAAGGGCCTTGGAGTCCAAACATCCGTTCGCAAGCTC
TACTCTCCCGCTTCAACCGCGCCCGCGACAAGGCACACGGGGCCCTAGCCGATGCCGAATCGGCACTTCCCTTCT
GCCTCAGAGAGCCGCGTCTAAAGGGGAGCTTCAAGCCGCTGGCGCCCATCTACACGGAAATCACCTACGTCCTCC
ACCAGATCATCGACAGGATGGACAATCTCGTTCAGCTACGGAGAACGTACGGCTCCTCCATCCTCGAAGACCTGA
ACCCAAAGGTGTACGCCTACAGGAGGAACGTGGCGGCCAGCACGACACTGATGCTCTTCTCCGTCAACGAGGCGC
TCACCAACTGGCTACCCCTCCCACAGTTCTTGCCCTCAGCCCGCCTCGCCCTCATCCGCCTCATCAGCCGCGTCC
GCGAAATCGTAGCCTCAGACAACACATCGCCCAGCCCCCGCACCGAACTAGACGAAGAGACGGCAACCCTCATCA
CCAAACGCAAGTTCCTATCCTGGAACGCCGGCGCCGTCGGCCAAATCGAAATCGTGGAATACCTCGAAGAACTCA
TCGAGCTCGTCAAGCTCCTCGTCGGCGTCAACGGCTTCCGAGGCGGCATGCTGGAGCAGTCGTCGTTCGGTGCAG
AGGTGCTGGTACAGACGGCGCGCACACCGGAGCCGGAGCCCGGTGAAAGCGGTGGTGGCTGGTCTCCGGTGCGCT
GGACGGCGACGACGGTGGAGGCCATTGATGAGTGCGAGACGGGTTCCGAAGGCGGGAGTTGGGATGAGGGCATTC
CGCTTAGCTTGCAGAGGGTTGGGACTCGGTTGAGGAGGGGGAGTTCTGTGGTGAGAAGGAGGACGGCGTCTTCGG
CTGGGATCGGGATTCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail