Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04042
Gene name
Locationscaffold_04:705261..706689
Strand+
Gene length (bp)1428
Transcript length (bp)1353
Coding sequence length (bp)1353
Protein length (aa) 451

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04938 SIP1 Survival motor neuron (SMN) interacting protein 1 (SIP1) 5.1E-31 76 429

GO

GO Term Description Terminal node
GO:0000387 spliceosomal snRNP assembly Yes
GO:0022618 ribonucleoprotein complex assembly No
GO:0043933 protein-containing complex organization No
GO:0071840 cellular component organization or biogenesis No
GO:0065003 protein-containing complex assembly No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0022607 cellular component assembly No
GO:0016043 cellular component organization No
GO:0071826 ribonucleoprotein complex subunit organization No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3311 0.9433 0.1465 0.0077 0.1301 0.0025 0.0542 0.0303 0.0235 0.0022

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup968
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1738
Ophiocordyceps australis map64 (Brazil) OphauB2|683
Ophiocordyceps camponoti-floridani Ophcf2|04042 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1421
Ophiocordyceps kimflemingae Ophio5|3122
Ophiocordyceps subramaniannii Hirsu2|7667

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04042
MSAAAPKRALEHDAHLGHGHVSDSSEGEPSPKRAKNRTGAHPRHHHQSAAIDPTWGQKYVFSGAADASSIPYGDE
SDFEDDSEAMAYLRDVRCEANGIAHVKVAPTAVIGPQLPDELRTTDEDARDDGPHEPADACAYYDDGAYVAEPGQ
DEADSGNDGTDLQDVYFASLLDRYRRLRRILHARLPPEADSRLPSSRPTYVSSGRHPSSPTFDVWIDLMSATDPL
PLQLALMSKQTVLHLLRLLLQGPFLRRGRSLTERTSRWLWALLARLPDPGEMRRFDVAQVRELGRRAVLLGTSAA
DMAALRAQLDDANGDVLAACEASDRADDDDAVIIHDDSDRCDDDESYVDTESHDPPPQDQDSESIEMDMSSDTDH
DALDAAKTALLARLQSPPPPDKTSAPSEAKQLAFNTRATLDMVLTVVGDFYGQRDLLDFRDPFSRIACDATVGLS
*
Coding >Ophcf2|04042
ATGTCTGCCGCTGCACCCAAACGAGCTCTTGAACATGACGCCCATCTCGGTCATGGCCACGTCTCCGACTCCTCC
GAAGGCGAGCCTAGCCCCAAGCGCGCAAAAAATAGAACGGGAGCTCACCCGCGTCATCACCATCAGAGCGCCGCC
ATCGATCCGACTTGGGGACAGAAATACGTCTTCTCCGGCGCGGCCGACGCTTCATCTATTCCTTATGGCGACGAG
TCCGACTTTGAGGATGACTCAGAAGCCATGGCTTACCTGCGAGACGTTCGCTGCGAGGCCAACGGTATCGCCCAC
GTCAAGGTCGCGCCCACGGCAGTGATTGGGCCTCAGCTACCCGATGAGCTCCGCACTACCGACGAAGATGCCCGA
GACGATGGCCCGCATGAGCCGGCCGACGCTTGCGCCTACTACGACGACGGCGCCTACGTGGCTGAGCCCGGACAG
GACGAGGCCGACAGCGGCAACGACGGGACGGACCTCCAAGACGTCTACTTCGCCTCCCTCCTCGACAGGTACCGC
CGCCTGCGCCGCATCCTGCACGCCCGCCTACCCCCGGAAGCCGACTCCCGGCTCCCGTCCTCGCGGCCGACGTAC
GTGTCCTCCGGCCGCCACCCCTCGTCGCCGACATTCGACGTCTGGATCGACCTCATGAGCGCCACGGACCCGCTC
CCGCTGCAGCTGGCCCTCATGTCCAAGCAGACGGTGCTACATCTCCTGCGCCTCCTCCTCCAAGGGCCCTTTCTG
CGCCGCGGCCGCTCCCTCACAGAGCGCACCAGTCGCTGGCTATGGGCGCTGCTCGCCCGTCTCCCGGATCCAGGC
GAGATGCGCCGCTTTGACGTGGCTCAGGTCCGCGAACTGGGCCGTCGAGCTGTCCTGCTCGGCACCTCGGCCGCT
GACATGGCCGCTCTCCGCGCGCAGCTGGATGATGCCAACGGCGACGTCCTGGCCGCCTGCGAGGCGTCCGACCGT
GCCGACGATGACGACGCCGTCATCATCCACGACGACAGCGACAGATGCGACGACGACGAAAGCTACGTCGACACC
GAGAGTCACGACCCGCCACCACAAGATCAAGACTCAGAGTCCATCGAAATGGACATGTCCTCCGACACAGATCAC
GACGCCCTCGACGCCGCCAAGACAGCCCTCCTCGCCCGCCTCCAATCGCCACCTCCGCCAGACAAGACGAGCGCC
CCGTCGGAAGCAAAGCAGCTGGCCTTCAACACGCGCGCCACTCTCGACATGGTTCTCACCGTGGTGGGCGACTTT
TACGGCCAGCGCGACTTGCTCGACTTTCGCGATCCCTTTTCCCGAATTGCTTGCGACGCTACGGTTGGTCTTTCT
TGA
Transcript >Ophcf2|04042
ATGTCTGCCGCTGCACCCAAACGAGCTCTTGAACATGACGCCCATCTCGGTCATGGCCACGTCTCCGACTCCTCC
GAAGGCGAGCCTAGCCCCAAGCGCGCAAAAAATAGAACGGGAGCTCACCCGCGTCATCACCATCAGAGCGCCGCC
ATCGATCCGACTTGGGGACAGAAATACGTCTTCTCCGGCGCGGCCGACGCTTCATCTATTCCTTATGGCGACGAG
TCCGACTTTGAGGATGACTCAGAAGCCATGGCTTACCTGCGAGACGTTCGCTGCGAGGCCAACGGTATCGCCCAC
GTCAAGGTCGCGCCCACGGCAGTGATTGGGCCTCAGCTACCCGATGAGCTCCGCACTACCGACGAAGATGCCCGA
GACGATGGCCCGCATGAGCCGGCCGACGCTTGCGCCTACTACGACGACGGCGCCTACGTGGCTGAGCCCGGACAG
GACGAGGCCGACAGCGGCAACGACGGGACGGACCTCCAAGACGTCTACTTCGCCTCCCTCCTCGACAGGTACCGC
CGCCTGCGCCGCATCCTGCACGCCCGCCTACCCCCGGAAGCCGACTCCCGGCTCCCGTCCTCGCGGCCGACGTAC
GTGTCCTCCGGCCGCCACCCCTCGTCGCCGACATTCGACGTCTGGATCGACCTCATGAGCGCCACGGACCCGCTC
CCGCTGCAGCTGGCCCTCATGTCCAAGCAGACGGTGCTACATCTCCTGCGCCTCCTCCTCCAAGGGCCCTTTCTG
CGCCGCGGCCGCTCCCTCACAGAGCGCACCAGTCGCTGGCTATGGGCGCTGCTCGCCCGTCTCCCGGATCCAGGC
GAGATGCGCCGCTTTGACGTGGCTCAGGTCCGCGAACTGGGCCGTCGAGCTGTCCTGCTCGGCACCTCGGCCGCT
GACATGGCCGCTCTCCGCGCGCAGCTGGATGATGCCAACGGCGACGTCCTGGCCGCCTGCGAGGCGTCCGACCGT
GCCGACGATGACGACGCCGTCATCATCCACGACGACAGCGACAGATGCGACGACGACGAAAGCTACGTCGACACC
GAGAGTCACGACCCGCCACCACAAGATCAAGACTCAGAGTCCATCGAAATGGACATGTCCTCCGACACAGATCAC
GACGCCCTCGACGCCGCCAAGACAGCCCTCCTCGCCCGCCTCCAATCGCCACCTCCGCCAGACAAGACGAGCGCC
CCGTCGGAAGCAAAGCAGCTGGCCTTCAACACGCGCGCCACTCTCGACATGGTTCTCACCGTGGTGGGCGACTTT
TACGGCCAGCGCGACTTGCTCGACTTTCGCGATCCCTTTTCCCGAATTGCTTGCGACGCTACGGTTGGTCTTTCT
TGA
Gene >Ophcf2|04042
ATGTCTGCCGCTGCACCCAAACGAGCTCTTGAACATGACGCCCATCTCGGTCATGGCCACGTCTCCGACTCCTCC
GAAGGCGAGCCTAGCCCCAAGCGCGCAAAAAATAGAACGGGAGCTCACCCGCGTCATCACCATCAGAGCGCCGCC
ATCGATCCGACTTGGGGACAGAAATACGTCTTCTCCGGCGCGGCCGACGCTTCATCTATTCCTTATGGCGACGAG
TCCGACTTTGAGGATGACTCAGAAGCCATGGCTTACCTGCGAGACGTTCGGTGTGTCGTAGTCCTCCCCCACCCC
CAACCACCTCTCCCCCCTTGTGAGAATATTGAATCCTAAAGTCTTGCCAGCTGCGAGGCCAACGGTATCGCCCAC
GTCAAGGTCGCGCCCACGGCAGTGATTGGGCCTCAGCTACCCGATGAGCTCCGCACTACCGACGAAGATGCCCGA
GACGATGGCCCGCATGAGCCGGCCGACGCTTGCGCCTACTACGACGACGGCGCCTACGTGGCTGAGCCCGGACAG
GACGAGGCCGACAGCGGCAACGACGGGACGGACCTCCAAGACGTCTACTTCGCCTCCCTCCTCGACAGGTACCGC
CGCCTGCGCCGCATCCTGCACGCCCGCCTACCCCCGGAAGCCGACTCCCGGCTCCCGTCCTCGCGGCCGACGTAC
GTGTCCTCCGGCCGCCACCCCTCGTCGCCGACATTCGACGTCTGGATCGACCTCATGAGCGCCACGGACCCGCTC
CCGCTGCAGCTGGCCCTCATGTCCAAGCAGACGGTGCTACATCTCCTGCGCCTCCTCCTCCAAGGGCCCTTTCTG
CGCCGCGGCCGCTCCCTCACAGAGCGCACCAGTCGCTGGCTATGGGCGCTGCTCGCCCGTCTCCCGGATCCAGGC
GAGATGCGCCGCTTTGACGTGGCTCAGGTCCGCGAACTGGGCCGTCGAGCTGTCCTGCTCGGCACCTCGGCCGCT
GACATGGCCGCTCTCCGCGCGCAGCTGGATGATGCCAACGGCGACGTCCTGGCCGCCTGCGAGGCGTCCGACCGT
GCCGACGATGACGACGCCGTCATCATCCACGACGACAGCGACAGATGCGACGACGACGAAAGCTACGTCGACACC
GAGAGTCACGACCCGCCACCACAAGATCAAGACTCAGAGTCCATCGAAATGGACATGTCCTCCGACACAGATCAC
GACGCCCTCGACGCCGCCAAGACAGCCCTCCTCGCCCGCCTCCAATCGCCACCTCCGCCAGACAAGACGAGCGCC
CCGTCGGAAGCAAAGCAGCTGGCCTTCAACACGCGCGCCACTCTCGACATGGTTCTCACCGTGGTGGGCGACTTT
TACGGCCAGCGCGACTTGCTCGACTTTCGCGATCCCTTTTCCCGAATTGCTTGCGACGCTACGGTTGGTCTTTCT
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail