Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04036
Gene name
Locationscaffold_04:691112..691604
Strand+
Gene length (bp)492
Transcript length (bp)351
Coding sequence length (bp)351
Protein length (aa) 117

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14138 COX16 Cytochrome c oxidase assembly protein COX16 4.3E-32 32 109

GO

GO Term Description Terminal node
GO:0031966 mitochondrial membrane Yes
GO:0005575 cellular_component No
GO:0031090 organelle membrane No
GO:0016020 membrane No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.5

Transmembrane Domains

Domain # Start End Length
1 31 50 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04036
MPTFQRNKFRGSAYANTLGGRYRALMKKHSFLAFGLPFISIIVAGSFVLTKVTAVRYERHDRKVRQLSKEEELGM
KKGGRKVDMREEYNRLAGRDLEKWEQRRVERLPGESDGILR*
Coding >Ophcf2|04036
ATGCCGACCTTTCAGCGTAACAAGTTCCGCGGCTCGGCCTATGCTAACACGCTCGGAGGCCGATACCGGGCGCTG
ATGAAGAAGCATTCGTTCCTGGCATTCGGCCTGCCCTTCATCTCCATCATCGTCGCCGGCTCCTTTGTCCTTACC
AAGGTGACGGCGGTCCGGTACGAGAGGCACGATCGCAAGGTGCGGCAATTGAGCAAGGAGGAAGAATTGGGGATG
AAGAAGGGGGGGCGAAAGGTCGACATGAGGGAAGAGTACAACAGGCTCGCAGGGAGAGACCTCGAAAAGTGGGAG
CAGAGGCGAGTCGAGAGGCTACCAGGCGAGAGCGACGGTATCTTGAGATGA
Transcript >Ophcf2|04036
ATGCCGACCTTTCAGCGTAACAAGTTCCGCGGCTCGGCCTATGCTAACACGCTCGGAGGCCGATACCGGGCGCTG
ATGAAGAAGCATTCGTTCCTGGCATTCGGCCTGCCCTTCATCTCCATCATCGTCGCCGGCTCCTTTGTCCTTACC
AAGGTGACGGCGGTCCGGTACGAGAGGCACGATCGCAAGGTGCGGCAATTGAGCAAGGAGGAAGAATTGGGGATG
AAGAAGGGGGGGCGAAAGGTCGACATGAGGGAAGAGTACAACAGGCTCGCAGGGAGAGACCTCGAAAAGTGGGAG
CAGAGGCGAGTCGAGAGGCTACCAGGCGAGAGCGACGGTATCTTGAGATGA
Gene >Ophcf2|04036
ATGCCGACCTTTCAGCGTAACAAGTTCCGCGGCTCGGCCTATGCTAACACGCTCGGAGGCCGATACCGGGCGCTG
ATGAAGAAGCATTCGTTCCTGGCATTCGGCCTGCCCTTCATCTCCATCATCGTCGCCGGCTCCTTTGTCCTTACC
AAGGTGACGGCGGTCCGGTACGAGAGGCACGATCGCAAGGTGCGGCAATTGAGCAAGGAGGAAGAATTGGGGATG
AAGAAGGGGGGGCGAAAGGTCGACATGAGGGAAGAGTACAACGTAGGTTGAAGCTCTGCATTTTTTTTTCCCCTA
TTCCCTTGCTGTTTGTTACCTTTTCTCGCCATCTTTGCACTGCCCCCATCACGATTCTGCCCATCTACGTAAATA
CTTGTCGCGCAGGGAGTGCTGAATCGTCGATAGAGGCTCGCAGGGAGAGACCTCGAAAAGTGGGAGCAGAGGCGA
GTCGAGAGGCTACCAGGCGAGAGCGACGGTATCTTGAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail