Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04035
Gene name
Locationscaffold_04:686976..690050
Strand+
Gene length (bp)3074
Transcript length (bp)2445
Coding sequence length (bp)2445
Protein length (aa) 815

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00498 FHA FHA domain 1.1E-15 239 316

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 784 806 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 45.36 26.09 64.63
Alive In ants, during behavior modification 46.32 26.09 66.56
Dead In ants, recently dead 45.81 25.95 65.68

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.932817 no
Alive Dead 0.960561 no
Dead Fungus 0.968159 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04035
MRPQAGSSQYARQCAHVVADWRNRTMKARHVDGDHGRSLAASRPRDGAKAFAAVISVNPHPAPRVLDSINRPICG
NSPMNPDQVRAMFAPRKQLTRSSSSSSISSNSSNTTIATNGSQPNGTPLSANTDMSPTSSDMSQWSNRPATGFKR
PPPKHTWLAKSDSQPDLTRGSVGRPSAMVNHHAPLQLTSGQLSMAQQTGMRAMGPDQFPPGQPVLFLLSLNGTFE
RKTIAVPFAPESLRIGRQTNQKTVPTPTNGFFDSKVLSRQHAEIYAERNGKVYIRDVKSSNGTFVNGTRLSLENR
ESDPHELQTADHLELGIDIVSEDQKTVVHHKVAAKVEHAGFLSNTSNVLDMNFGDLDPANGTMLVPNCLLQMRGR
AGNNASVGNNGGRMVAGGGMMASQNNALAQQQRPFFVSPIATEQILKRLTNEMRNVRLQSQDLNRMNVFVNRLLS
KDDVKDLEKSDMPEPSKPIMNGSGIPFRTDGKNRFSDPPAPPPQQPLPEKPDVLSLKRGPGERPRISTSSPASLR
QENLGQVIQLTEALNNVKRDMESQSVRVRELEMMLQKEREARELAEELARRFEESANDQTISATPTNGFWGSAYD
DPKPASDASETNIGGDEIDEESYIADDADLDAAPALQSRIDTMERQMRNLREQMEMWKQRCETAETERDEGRQSL
ADMVVRLRAEEAKRHGETSRGQSRRGRSGLREQPGNEAKSSSGVDGAGPETEAGAAADVMSQGDARGDSSAVRGG
GGDGGDGGDDDDGDDGAGQATADGLRERYVEAALPYASMLGVVLIGMSLMAYINGWQPPSPQME*
Coding >Ophcf2|04035
ATGCGACCGCAGGCAGGCTCCTCACAGTACGCTCGACAGTGCGCCCATGTCGTGGCTGACTGGCGGAACCGCACG
ATGAAGGCGCGTCACGTGGACGGCGATCATGGCCGCTCCCTCGCTGCATCGCGGCCACGAGACGGTGCCAAGGCC
TTCGCCGCTGTCATTTCAGTGAATCCGCATCCAGCCCCTCGCGTTCTCGACAGCATCAACCGACCTATTTGCGGC
AACAGCCCCATGAACCCCGACCAAGTCAGAGCCATGTTTGCCCCACGCAAGCAACTCACCCGATCCTCGTCGTCG
TCGTCCATCTCCTCCAACTCGTCAAACACCACCATCGCCACCAACGGCTCACAACCGAATGGTACTCCGCTATCT
GCCAATACGGACATGAGTCCCACCTCCTCCGACATGAGTCAATGGTCTAACCGCCCTGCCACTGGCTTCAAGCGG
CCGCCGCCCAAGCATACATGGCTCGCCAAGAGCGACTCGCAGCCGGACCTGACGAGAGGCTCGGTCGGTCGCCCG
AGCGCCATGGTAAACCACCACGCGCCACTGCAGCTGACGTCGGGTCAGCTCTCGATGGCCCAGCAGACGGGCATG
CGCGCCATGGGGCCCGACCAGTTTCCGCCCGGCCAGCCGGTGCTGTTCCTCCTCTCGCTCAACGGGACCTTTGAG
AGAAAGACAATCGCCGTGCCCTTTGCCCCCGAAAGCCTTCGCATCGGCCGGCAGACGAACCAGAAGACGGTGCCG
ACCCCCACCAACGGCTTCTTCGATAGCAAAGTGCTGTCTAGGCAACACGCTGAGATTTATGCCGAGCGAAACGGC
AAGGTGTATATCCGTGACGTCAAATCGTCCAATGGCACCTTTGTCAACGGCACTCGTCTCTCCCTGGAGAACCGC
GAGTCGGATCCCCACGAGCTGCAGACGGCCGACCACCTCGAACTTGGCATCGACATTGTCAGCGAAGATCAGAAG
ACGGTCGTGCACCACAAAGTCGCGGCCAAGGTCGAGCACGCCGGGTTCCTAAGCAATACCAGCAACGTGCTGGAC
ATGAACTTTGGCGATCTAGACCCTGCCAACGGCACCATGCTGGTCCCCAATTGCCTGTTACAGATGCGGGGGAGA
GCTGGGAACAACGCCTCTGTCGGCAACAATGGCGGGCGCATGGTGGCGGGTGGCGGGATGATGGCCTCCCAGAAT
AACGCCTTAGCACAGCAGCAGCGACCTTTCTTCGTCTCTCCGATAGCCACGGAGCAGATCCTCAAGCGCTTGACG
AACGAGATGCGCAATGTCCGGCTGCAGTCTCAGGATTTGAATCGCATGAACGTGTTCGTCAACAGGCTCCTTTCC
AAGGACGACGTCAAGGATCTCGAGAAGTCCGACATGCCCGAGCCGTCGAAACCCATAATGAATGGGAGCGGCATC
CCGTTCCGCACCGACGGCAAGAATCGCTTCTCCGATCCGCCTGCGCCTCCGCCGCAACAGCCTCTTCCGGAAAAG
CCCGACGTTCTGTCACTCAAGCGCGGGCCGGGCGAGCGACCCAGGATCTCAACGTCGAGCCCCGCATCGTTAAGG
CAGGAAAATCTCGGCCAGGTTATTCAACTGACAGAGGCGCTGAACAACGTCAAGCGAGACATGGAGTCTCAGAGT
GTCCGTGTGCGCGAGCTGGAGATGATGCTTCAGAAGGAGCGGGAGGCGCGGGAGCTGGCCGAGGAGCTCGCCAGG
CGATTCGAGGAGTCGGCCAACGACCAGACGATTTCGGCGACGCCGACCAACGGATTCTGGGGGTCCGCCTATGAC
GACCCGAAGCCGGCATCAGACGCGTCGGAGACGAATATTGGGGGGGACGAGATAGACGAGGAGTCCTACATAGCA
GATGACGCCGACCTGGACGCCGCGCCAGCACTTCAGTCCCGGATCGACACGATGGAAAGACAGATGCGCAACCTC
CGAGAACAGATGGAGATGTGGAAGCAACGCTGCGAGACTGCCGAGACGGAACGCGACGAGGGACGACAGTCTTTG
GCTGACATGGTGGTGCGGCTCCGAGCGGAAGAGGCCAAGCGGCACGGAGAGACGTCCCGGGGGCAATCAAGAAGG
GGTCGCTCCGGACTGCGAGAGCAACCTGGCAACGAAGCCAAGTCATCATCGGGAGTCGACGGCGCAGGGCCGGAG
ACGGAGGCGGGAGCAGCAGCAGACGTCATGTCTCAGGGTGACGCGCGGGGGGACTCATCGGCTGTCCGGGGAGGC
GGCGGCGATGGCGGCGATGGCGGTGATGACGATGACGGGGACGATGGCGCGGGACAGGCGACGGCGGATGGGTTA
AGGGAGCGTTACGTCGAAGCCGCGCTCCCATACGCGTCGATGTTGGGGGTGGTGCTGATCGGGATGAGTCTGATG
GCGTACATTAACGGATGGCAGCCTCCTAGTCCGCAGATGGAGTGA
Transcript >Ophcf2|04035
ATGCGACCGCAGGCAGGCTCCTCACAGTACGCTCGACAGTGCGCCCATGTCGTGGCTGACTGGCGGAACCGCACG
ATGAAGGCGCGTCACGTGGACGGCGATCATGGCCGCTCCCTCGCTGCATCGCGGCCACGAGACGGTGCCAAGGCC
TTCGCCGCTGTCATTTCAGTGAATCCGCATCCAGCCCCTCGCGTTCTCGACAGCATCAACCGACCTATTTGCGGC
AACAGCCCCATGAACCCCGACCAAGTCAGAGCCATGTTTGCCCCACGCAAGCAACTCACCCGATCCTCGTCGTCG
TCGTCCATCTCCTCCAACTCGTCAAACACCACCATCGCCACCAACGGCTCACAACCGAATGGTACTCCGCTATCT
GCCAATACGGACATGAGTCCCACCTCCTCCGACATGAGTCAATGGTCTAACCGCCCTGCCACTGGCTTCAAGCGG
CCGCCGCCCAAGCATACATGGCTCGCCAAGAGCGACTCGCAGCCGGACCTGACGAGAGGCTCGGTCGGTCGCCCG
AGCGCCATGGTAAACCACCACGCGCCACTGCAGCTGACGTCGGGTCAGCTCTCGATGGCCCAGCAGACGGGCATG
CGCGCCATGGGGCCCGACCAGTTTCCGCCCGGCCAGCCGGTGCTGTTCCTCCTCTCGCTCAACGGGACCTTTGAG
AGAAAGACAATCGCCGTGCCCTTTGCCCCCGAAAGCCTTCGCATCGGCCGGCAGACGAACCAGAAGACGGTGCCG
ACCCCCACCAACGGCTTCTTCGATAGCAAAGTGCTGTCTAGGCAACACGCTGAGATTTATGCCGAGCGAAACGGC
AAGGTGTATATCCGTGACGTCAAATCGTCCAATGGCACCTTTGTCAACGGCACTCGTCTCTCCCTGGAGAACCGC
GAGTCGGATCCCCACGAGCTGCAGACGGCCGACCACCTCGAACTTGGCATCGACATTGTCAGCGAAGATCAGAAG
ACGGTCGTGCACCACAAAGTCGCGGCCAAGGTCGAGCACGCCGGGTTCCTAAGCAATACCAGCAACGTGCTGGAC
ATGAACTTTGGCGATCTAGACCCTGCCAACGGCACCATGCTGGTCCCCAATTGCCTGTTACAGATGCGGGGGAGA
GCTGGGAACAACGCCTCTGTCGGCAACAATGGCGGGCGCATGGTGGCGGGTGGCGGGATGATGGCCTCCCAGAAT
AACGCCTTAGCACAGCAGCAGCGACCTTTCTTCGTCTCTCCGATAGCCACGGAGCAGATCCTCAAGCGCTTGACG
AACGAGATGCGCAATGTCCGGCTGCAGTCTCAGGATTTGAATCGCATGAACGTGTTCGTCAACAGGCTCCTTTCC
AAGGACGACGTCAAGGATCTCGAGAAGTCCGACATGCCCGAGCCGTCGAAACCCATAATGAATGGGAGCGGCATC
CCGTTCCGCACCGACGGCAAGAATCGCTTCTCCGATCCGCCTGCGCCTCCGCCGCAACAGCCTCTTCCGGAAAAG
CCCGACGTTCTGTCACTCAAGCGCGGGCCGGGCGAGCGACCCAGGATCTCAACGTCGAGCCCCGCATCGTTAAGG
CAGGAAAATCTCGGCCAGGTTATTCAACTGACAGAGGCGCTGAACAACGTCAAGCGAGACATGGAGTCTCAGAGT
GTCCGTGTGCGCGAGCTGGAGATGATGCTTCAGAAGGAGCGGGAGGCGCGGGAGCTGGCCGAGGAGCTCGCCAGG
CGATTCGAGGAGTCGGCCAACGACCAGACGATTTCGGCGACGCCGACCAACGGATTCTGGGGGTCCGCCTATGAC
GACCCGAAGCCGGCATCAGACGCGTCGGAGACGAATATTGGGGGGGACGAGATAGACGAGGAGTCCTACATAGCA
GATGACGCCGACCTGGACGCCGCGCCAGCACTTCAGTCCCGGATCGACACGATGGAAAGACAGATGCGCAACCTC
CGAGAACAGATGGAGATGTGGAAGCAACGCTGCGAGACTGCCGAGACGGAACGCGACGAGGGACGACAGTCTTTG
GCTGACATGGTGGTGCGGCTCCGAGCGGAAGAGGCCAAGCGGCACGGAGAGACGTCCCGGGGGCAATCAAGAAGG
GGTCGCTCCGGACTGCGAGAGCAACCTGGCAACGAAGCCAAGTCATCATCGGGAGTCGACGGCGCAGGGCCGGAG
ACGGAGGCGGGAGCAGCAGCAGACGTCATGTCTCAGGGTGACGCGCGGGGGGACTCATCGGCTGTCCGGGGAGGC
GGCGGCGATGGCGGCGATGGCGGTGATGACGATGACGGGGACGATGGCGCGGGACAGGCGACGGCGGATGGGTTA
AGGGAGCGTTACGTCGAAGCCGCGCTCCCATACGCGTCGATGTTGGGGGTGGTGCTGATCGGGATGAGTCTGATG
GCGTACATTAACGGATGGCAGCCTCCTAGTCCGCAGATGGAGTGA
Gene >Ophcf2|04035
ATGCGACCGCAGGCAGGCTCCTCACAGTACGCTCGACAGTGCGCCCATGTCGTGGCTGACTGGCGGAACCGCACG
ATGAAGGCGCGTCACGTGGACGGCGATCATGGTGCCTACCTTTTGCCCTCTCCATCTCTTAAAAACTGCAAGAAT
CGCCAGCACCGACGACCTCGTTCGTCGTCGGCCTCGACGAGATCCCCCCCCCGACGCTCGCATCTTCCCCGAGGC
TAAGCGTTGAGCCGCCGCCCAGACACAGGCGCTTAGTCTCCACCGAGCACTGTACGAACGTGGCTTCAAACCCCT
CCTAGGCCGCTCCCTCGCTGCATCGCGGCCACGAGACGGTGCCAAGGCCTTCGCCGCTGTCATTTCAGTGAATCC
GGTACGTCGTTGCGCCGTTCTTCGCGCCCTGCAGGCCCGGTTCGTATTCGACCTGCCGTTCCGCCTCGTCGGTCG
GCATTGGGATGTTTGGGTTCGCTGACGAGATTTCGGACGGCAGCATCCAGCCCCTCGCGTTCTCGACAGCATCAA
CCGACCTATTTGGTAGGAGTCGCGCCTCATCCTGAAGCCGCCGTTTTCACCTGCCTCTCTCATTACATCTCATCT
CATCTCGTGTATTTCGCCGTGACGGATTCGACGACCTACCCATTTCGACTTCCTACACGACGAAAACCACGGGAA
TCACATTTCCCTTCCCTCCCCTATCGCCTTCCTACGCCTCGCCTAATCTTTCCCCATGACCGCCGTGGCGAGTCC
CCCGACCTTTCCTCAGATTTCGAGACCAGCATGGGGGGCTGTTAGCGGCAACAGCCCCATGAACCCCGACCAAGT
CAGAGCCATGTTTGCCCCACGCAAGCAACTCACCCGATCCTCGTCGTCGTCGTCCATCTCCTCCAACTCGTCAAA
CACCACCATCGCCACCAACGGCTCACAACCGAATGGTACTCCGCTATCTGCCAATACGGACATGAGTCCCACCTC
CTCCGACATGAGTCAATGGTCTAACCGCCCTGCCACTGGCTTCAAGCGGCCGCCGCCCAAGCATACATGGCTCGC
CAAGAGCGACTCGCAGCCGGACCTGACGAGAGGCTCGGTCGGTCGCCCGAGCGCCATGGTAAACCACCACGCGCC
ACTGCAGCTGACGTCGGGTCAGCTCTCGATGGCCCAGCAGACGGGCATGCGCGCCATGGGGCCCGACCAGTTTCC
GCCCGGCCAGCCGGTGCTGTTCCTCCTCTCGCTCAACGGGACCTTTGAGAGAAAGACAATCGCCGTGCCCTTTGC
CCCCGAAAGCCTTCGCATCGGCCGGCAGACGAACCAGAAGACGGTGCCGACCCCCACCAACGGCTTCTTCGATAG
CAAAGTGCTGTCTAGGCAACACGCTGAGATTTATGCCGAGCGAAACGGCAAGGTGTATATCCGTGACGTCAAATC
GTCCAATGGCACCTTTGTCAACGGCACTCGTCTCTCCCTGGAGAACCGCGAGTCGGATCCCCACGAGCTGCAGAC
GGCCGACCACCTCGAACTTGGCATCGACATTGTCAGCGAAGATCAGAAGACGGTCGTGCACCACAAAGTCGCGGC
CAAGGTCGAGCACGCCGGGTTCCTAAGCAATACCAGCAACGTGCTGGACATGAACTTTGGCGATCTAGACCCTGC
CAACGGCACCATGCTGGTCCCCAATTGCCTGTTACAGATGCGGGGGAGAGCTGGGAACAACGCCTCTGTCGGCAA
CAATGGCGGGCGCATGGTGGCGGGTGGCGGGATGATGGCCTCCCAGAATAACGCCTTAGCACAGCAGCAGCGACC
TTTCTTCGTCTCTCCGATAGCCACGGAGCAGATCCTCAAGCGCTTGACGGTTAGTACTAGGCTTCCTTTAACCCT
TTTTTTCCCTTTTTTCTGACGCGCGGCAGAACGAGATGCGCAATGTCCGGCTGCAGTCTCAGGATTTGAATCGCA
TGAACGTGTTCGTCAACAGGCTCCTTTCCAAGGACGACGTCAAGGATCTCGAGAAGTCCGACATGCCCGAGCCGT
CGAAACCCATAATGAATGGGAGCGGCATCCCGTTCCGCACCGACGGCAAGAATCGCTTCTCCGATCCGCCTGCGC
CTCCGCCGCAACAGCCTCTTCCGGAAAAGCCCGACGTTCTGTCACTCAAGCGCGGGCCGGGCGAGCGACCCAGGA
TCTCAACGTCGAGCCCCGCATCGTTAAGGCAGGAAAATCTCGGCCAGGTTATTCAACTGACAGAGGCGCTGAACA
ACGTCAAGCGAGACATGGAGTCTCAGAGTGTCCGTGTGCGCGAGCTGGAGATGATGCTTCAGAAGGAGCGGGAGG
CGCGGGAGCTGGCCGAGGAGCTCGCCAGGCGATTCGAGGAGTCGGCCAACGACCAGACGATTTCGGCGACGCCGA
CCAACGGATTCTGGGGGTCCGCCTATGACGACCCGAAGCCGGCATCAGACGCGTCGGAGACGAATATTGGGGGGG
ACGAGATAGACGAGGAGTCCTACATAGCAGATGACGCCGACCTGGACGCCGCGCCAGCACTTCAGTCCCGGATCG
ACACGATGGAAAGACAGATGCGCAACCTCCGAGAACAGATGGAGATGTGGAAGCAACGCTGCGAGACTGCCGAGA
CGGAACGCGACGAGGGACGACAGTCTTTGGCTGACATGGTGGTGCGGCTCCGAGCGGAAGAGGCCAAGCGGCACG
GAGAGACGTCCCGGGGGCAATCAAGAAGGGGTCGCTCCGGACTGCGAGAGCAACCTGGCAACGAAGCCAAGTCAT
CATCGGGAGTCGACGGCGCAGGGCCGGAGACGGAGGCGGGAGCAGCAGCAGACGTCATGTCTCAGGGTGACGCGC
GGGGGGACTCATCGGCTGTCCGGGGAGGCGGCGGCGATGGCGGCGATGGCGGTGATGACGATGACGGGGACGATG
GCGCGGGACAGGCGACGGCGGATGGGTTAAGGGAGCGTTACGTCGAAGCCGCGCTCCCATACGCGTCGATGTTGG
GGGTGGTGCTGATCGGGATGAGTCTGATGGCGTACATTAACGGATGGCAGCCTCCTAGTCCGCAGATGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail