Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04028
Gene name
Locationscaffold_04:669629..672879
Strand+
Gene length (bp)3250
Transcript length (bp)3054
Coding sequence length (bp)3054
Protein length (aa) 1018

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12812 PDZ_1 PDZ-like domain 1.2E-35 396 471
PF12812 PDZ_1 PDZ-like domain 5.6E-17 870 947
PF13365 Trypsin_2 Trypsin-like peptidase domain 8.5E-19 107 252

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3692 0.7786 0.1252 0.0385 0.0881 0.0519 0.1526 0.0398 0.1232 0.0085

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2476
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5807
Ophiocordyceps australis map64 (Brazil) OphauB2|2740
Ophiocordyceps camponoti-floridani Ophcf2|04028 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|474
Ophiocordyceps kimflemingae Ophio5|3961
Ophiocordyceps subramaniannii Hirsu2|3575

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04028
MKGTRSRPSAAGKRKSPVSPGQPPPSKRSLNGRLTSDDAEFDGDDDGGLLEEDFEDDVHDHNSLYIDSPGSLGEW
QDTIQKVVCNVVAIRFCQTCSFDTDPALTSEATGFVVDAQRGYIMTNRHVVGAGPFWGHCVFDNHEEVDCYPVYR
DPVHDFGILRYDPKAIKYMHVDGLDLRPDQAKVGVEIRVVGNDAGEKLSILSGVISRLDRNAPEYGEGYSDFNTC
YYQANAAASGGSSGSPVVSKDGAAVALQAGGRSDGASTDYFLPLDRPLRALQCIQQGKPVTRGDIQCQFLLKPFD
ECRRLGLSPHWEAAMREAFPNETNLLVAEIVLASGPSCGKIEEGDVLIKVNGELITQFIRLDDILDENVGKSVTV
MLQRGGQDVAVEIEVGDLHRITPDRFVTVAGASFHNLSYQQARLYAVAVQGVYVCESAGSFRFDNTDNGWIVQTI
DHKKVPDLDAFIAVMKAIPDKARVVVTYKHLRDLHTLNTSVIYVDRHWSSKMKMAVRNDSTGLWDFSDLGTALPP
VPPVRRSASFIELDHMPHPGIADLIRSFVHVNCTMPVKLDGFPKNRRWGMGLVIDADKGLVLISRAIVPYDLCDI
TVTIADSVIVEGKVVFLHPLQNYAIIRYDPALVDAPVKSATMSGEHLTQGAKTYFLGHNRIGRVVHGATTVTEIT
AVAIPANSGAPRYRAVNVDAITIDSNLGSTCNSGVLVSPDGTVQALWLSYLGERSPCSQRDEEYYLGLGTPTLLP
VIGAIQKGETPRLRMLSVELRSVQMSQARVMGVSDEWIKKVTQANRSHHQLFMVSKRTFERGEHPVSLLEGDIVL
TLNGKMCTTISDFDVMYTSEVLDAVIVRECEELRLQLPTVAATDMETDHAVSFCGAVLHRPHQAVRQQISKLHSE
VYVSSRIRGSPAYQYGVAPTNFITHVNGRPTPDLTSFIAATREIPDNTYFRLKAVTFDSVPWVITMKKNDHYFPT
MEWIKDGNEACGWRRVTYEGRDVFQGEATDGVPRVVEDTEME*
Coding >Ophcf2|04028
ATGAAGGGCACTCGCTCTCGGCCTTCTGCCGCCGGCAAGAGGAAGTCTCCCGTGTCGCCCGGACAGCCGCCTCCG
TCGAAGCGATCCCTTAACGGGAGACTTACGTCGGATGATGCCGAGTTCGACGGCGACGACGACGGTGGCCTTCTT
GAAGAGGACTTTGAAGACGATGTTCACGACCACAACTCGTTGTATATTGATTCTCCCGGCAGCTTGGGCGAGTGG
CAGGACACGATCCAAAAGGTGGTCTGCAACGTCGTCGCCATCCGCTTCTGCCAGACATGCTCGTTCGATACCGAT
CCGGCTTTGACGAGCGAGGCCACCGGCTTCGTTGTTGACGCTCAACGAGGATACATCATGACGAACCGACATGTC
GTCGGTGCAGGTCCCTTTTGGGGTCACTGCGTGTTTGACAATCACGAAGAAGTTGACTGCTATCCCGTCTATCGC
GATCCCGTCCACGATTTTGGCATCTTGCGTTACGACCCAAAGGCCATCAAGTACATGCACGTCGACGGCTTGGAC
TTGAGGCCGGACCAGGCCAAAGTGGGCGTCGAGATCCGCGTCGTAGGCAACGATGCCGGCGAGAAACTCAGCATC
CTGTCCGGCGTCATCAGCCGCCTGGACCGCAACGCCCCCGAGTACGGCGAAGGATACAGCGACTTCAACACTTGC
TACTACCAGGCCAACGCCGCGGCTAGCGGTGGCAGCTCGGGCAGTCCCGTCGTCAGCAAGGACGGCGCGGCAGTG
GCCCTACAGGCTGGCGGCCGCTCAGACGGTGCATCGACGGACTACTTCCTCCCCCTGGACCGCCCCCTGCGAGCT
CTGCAGTGCATCCAGCAGGGCAAGCCCGTCACCCGCGGCGATATCCAGTGCCAGTTCCTGCTCAAACCCTTTGAC
GAGTGCCGTAGGCTGGGCCTCAGTCCGCATTGGGAGGCGGCCATGCGCGAGGCCTTTCCCAACGAGACCAACCTG
CTGGTGGCCGAGATCGTCCTCGCGTCGGGCCCCTCGTGCGGTAAGATCGAGGAGGGCGACGTCTTGATCAAGGTC
AACGGGGAGCTCATCACGCAATTCATCCGTCTCGACGACATCCTCGACGAAAACGTCGGCAAGTCGGTGACGGTC
ATGCTGCAGCGTGGTGGGCAGGACGTGGCGGTCGAGATTGAGGTCGGCGACCTGCACCGCATCACGCCGGACCGC
TTCGTCACCGTGGCCGGCGCGAGCTTTCACAACCTGTCGTACCAGCAGGCCAGGCTGTATGCCGTGGCCGTTCAG
GGCGTCTACGTCTGCGAGTCGGCCGGCTCCTTCAGGTTCGACAACACGGACAACGGTTGGATCGTTCAGACCATC
GACCACAAAAAGGTGCCCGATCTCGATGCCTTCATCGCCGTCATGAAGGCCATTCCCGACAAGGCGAGGGTGGTG
GTGACGTACAAGCACCTCCGCGACTTGCACACTCTCAACACGTCCGTCATCTACGTCGACCGTCACTGGTCCTCC
AAGATGAAGATGGCCGTCCGCAACGACAGCACCGGCCTATGGGACTTTTCCGACCTGGGCACCGCCCTTCCGCCC
GTGCCGCCCGTCCGCCGCTCAGCCTCGTTCATCGAGCTCGACCACATGCCGCACCCGGGCATCGCCGACCTCATC
CGCAGCTTCGTCCACGTCAACTGCACCATGCCCGTCAAGCTCGACGGGTTCCCCAAGAACCGGCGTTGGGGGATG
GGCCTCGTCATCGACGCCGACAAGGGCCTGGTGCTCATCTCTAGGGCTATCGTGCCCTACGACCTCTGCGACATC
ACCGTCACCATCGCCGACTCGGTCATCGTCGAGGGCAAGGTCGTCTTCTTGCACCCGCTGCAGAACTACGCCATC
ATCCGCTACGATCCGGCCCTCGTCGACGCGCCCGTCAAGAGCGCAACCATGAGCGGCGAGCATCTCACGCAGGGC
GCCAAGACGTACTTCTTGGGCCACAACCGCATAGGGCGCGTCGTCCACGGGGCCACTACGGTCACCGAGATCACG
GCCGTCGCCATCCCGGCCAACTCGGGCGCGCCGCGGTACCGGGCCGTCAACGTCGACGCCATCACCATCGACAGC
AACCTCGGGTCGACTTGCAACAGCGGCGTGCTGGTGTCTCCGGACGGCACCGTCCAGGCGCTGTGGCTGTCGTAC
CTGGGCGAGCGGTCGCCCTGCAGCCAGCGGGACGAGGAGTACTATCTGGGGCTGGGCACGCCGACGCTGCTGCCC
GTCATCGGCGCCATTCAGAAGGGCGAGACGCCGCGACTGAGGATGCTGTCGGTCGAGCTGCGGTCGGTGCAGATG
TCCCAGGCGCGCGTCATGGGCGTCTCGGACGAATGGATCAAGAAGGTGACGCAGGCGAACCGATCTCACCACCAG
CTCTTCATGGTCAGCAAGCGTACATTTGAGCGCGGCGAGCATCCCGTCTCCCTGCTCGAGGGCGACATCGTCCTC
ACGCTGAACGGCAAGATGTGCACCACCATCTCTGACTTTGACGTCATGTACACCAGCGAGGTGCTCGACGCCGTC
ATCGTCCGCGAGTGCGAGGAGCTACGGCTGCAGCTACCGACGGTGGCCGCTACCGATATGGAGACGGATCACGCC
GTCTCCTTCTGCGGCGCCGTTCTGCATCGTCCGCACCAGGCTGTGCGGCAGCAGATCAGCAAGCTGCATAGCGAA
GTCTACGTGTCGAGCCGCATCCGGGGTTCGCCCGCCTATCAATATGGCGTCGCCCCGACCAACTTCATCACGCAC
GTCAACGGCCGCCCGACGCCGGATCTCACTTCTTTCATCGCCGCCACGCGCGAGATTCCGGACAATACCTACTTT
CGCCTCAAGGCCGTCACGTTTGATAGCGTGCCGTGGGTGATTACGATGAAGAAGAACGACCACTACTTCCCGACC
ATGGAGTGGATCAAGGACGGGAACGAGGCCTGTGGCTGGCGGCGTGTGACGTATGAGGGGAGAGACGTCTTTCAA
GGGGAAGCTACCGACGGGGTGCCGCGTGTGGTTGAGGATACAGAGATGGAGTGA
Transcript >Ophcf2|04028
ATGAAGGGCACTCGCTCTCGGCCTTCTGCCGCCGGCAAGAGGAAGTCTCCCGTGTCGCCCGGACAGCCGCCTCCG
TCGAAGCGATCCCTTAACGGGAGACTTACGTCGGATGATGCCGAGTTCGACGGCGACGACGACGGTGGCCTTCTT
GAAGAGGACTTTGAAGACGATGTTCACGACCACAACTCGTTGTATATTGATTCTCCCGGCAGCTTGGGCGAGTGG
CAGGACACGATCCAAAAGGTGGTCTGCAACGTCGTCGCCATCCGCTTCTGCCAGACATGCTCGTTCGATACCGAT
CCGGCTTTGACGAGCGAGGCCACCGGCTTCGTTGTTGACGCTCAACGAGGATACATCATGACGAACCGACATGTC
GTCGGTGCAGGTCCCTTTTGGGGTCACTGCGTGTTTGACAATCACGAAGAAGTTGACTGCTATCCCGTCTATCGC
GATCCCGTCCACGATTTTGGCATCTTGCGTTACGACCCAAAGGCCATCAAGTACATGCACGTCGACGGCTTGGAC
TTGAGGCCGGACCAGGCCAAAGTGGGCGTCGAGATCCGCGTCGTAGGCAACGATGCCGGCGAGAAACTCAGCATC
CTGTCCGGCGTCATCAGCCGCCTGGACCGCAACGCCCCCGAGTACGGCGAAGGATACAGCGACTTCAACACTTGC
TACTACCAGGCCAACGCCGCGGCTAGCGGTGGCAGCTCGGGCAGTCCCGTCGTCAGCAAGGACGGCGCGGCAGTG
GCCCTACAGGCTGGCGGCCGCTCAGACGGTGCATCGACGGACTACTTCCTCCCCCTGGACCGCCCCCTGCGAGCT
CTGCAGTGCATCCAGCAGGGCAAGCCCGTCACCCGCGGCGATATCCAGTGCCAGTTCCTGCTCAAACCCTTTGAC
GAGTGCCGTAGGCTGGGCCTCAGTCCGCATTGGGAGGCGGCCATGCGCGAGGCCTTTCCCAACGAGACCAACCTG
CTGGTGGCCGAGATCGTCCTCGCGTCGGGCCCCTCGTGCGGTAAGATCGAGGAGGGCGACGTCTTGATCAAGGTC
AACGGGGAGCTCATCACGCAATTCATCCGTCTCGACGACATCCTCGACGAAAACGTCGGCAAGTCGGTGACGGTC
ATGCTGCAGCGTGGTGGGCAGGACGTGGCGGTCGAGATTGAGGTCGGCGACCTGCACCGCATCACGCCGGACCGC
TTCGTCACCGTGGCCGGCGCGAGCTTTCACAACCTGTCGTACCAGCAGGCCAGGCTGTATGCCGTGGCCGTTCAG
GGCGTCTACGTCTGCGAGTCGGCCGGCTCCTTCAGGTTCGACAACACGGACAACGGTTGGATCGTTCAGACCATC
GACCACAAAAAGGTGCCCGATCTCGATGCCTTCATCGCCGTCATGAAGGCCATTCCCGACAAGGCGAGGGTGGTG
GTGACGTACAAGCACCTCCGCGACTTGCACACTCTCAACACGTCCGTCATCTACGTCGACCGTCACTGGTCCTCC
AAGATGAAGATGGCCGTCCGCAACGACAGCACCGGCCTATGGGACTTTTCCGACCTGGGCACCGCCCTTCCGCCC
GTGCCGCCCGTCCGCCGCTCAGCCTCGTTCATCGAGCTCGACCACATGCCGCACCCGGGCATCGCCGACCTCATC
CGCAGCTTCGTCCACGTCAACTGCACCATGCCCGTCAAGCTCGACGGGTTCCCCAAGAACCGGCGTTGGGGGATG
GGCCTCGTCATCGACGCCGACAAGGGCCTGGTGCTCATCTCTAGGGCTATCGTGCCCTACGACCTCTGCGACATC
ACCGTCACCATCGCCGACTCGGTCATCGTCGAGGGCAAGGTCGTCTTCTTGCACCCGCTGCAGAACTACGCCATC
ATCCGCTACGATCCGGCCCTCGTCGACGCGCCCGTCAAGAGCGCAACCATGAGCGGCGAGCATCTCACGCAGGGC
GCCAAGACGTACTTCTTGGGCCACAACCGCATAGGGCGCGTCGTCCACGGGGCCACTACGGTCACCGAGATCACG
GCCGTCGCCATCCCGGCCAACTCGGGCGCGCCGCGGTACCGGGCCGTCAACGTCGACGCCATCACCATCGACAGC
AACCTCGGGTCGACTTGCAACAGCGGCGTGCTGGTGTCTCCGGACGGCACCGTCCAGGCGCTGTGGCTGTCGTAC
CTGGGCGAGCGGTCGCCCTGCAGCCAGCGGGACGAGGAGTACTATCTGGGGCTGGGCACGCCGACGCTGCTGCCC
GTCATCGGCGCCATTCAGAAGGGCGAGACGCCGCGACTGAGGATGCTGTCGGTCGAGCTGCGGTCGGTGCAGATG
TCCCAGGCGCGCGTCATGGGCGTCTCGGACGAATGGATCAAGAAGGTGACGCAGGCGAACCGATCTCACCACCAG
CTCTTCATGGTCAGCAAGCGTACATTTGAGCGCGGCGAGCATCCCGTCTCCCTGCTCGAGGGCGACATCGTCCTC
ACGCTGAACGGCAAGATGTGCACCACCATCTCTGACTTTGACGTCATGTACACCAGCGAGGTGCTCGACGCCGTC
ATCGTCCGCGAGTGCGAGGAGCTACGGCTGCAGCTACCGACGGTGGCCGCTACCGATATGGAGACGGATCACGCC
GTCTCCTTCTGCGGCGCCGTTCTGCATCGTCCGCACCAGGCTGTGCGGCAGCAGATCAGCAAGCTGCATAGCGAA
GTCTACGTGTCGAGCCGCATCCGGGGTTCGCCCGCCTATCAATATGGCGTCGCCCCGACCAACTTCATCACGCAC
GTCAACGGCCGCCCGACGCCGGATCTCACTTCTTTCATCGCCGCCACGCGCGAGATTCCGGACAATACCTACTTT
CGCCTCAAGGCCGTCACGTTTGATAGCGTGCCGTGGGTGATTACGATGAAGAAGAACGACCACTACTTCCCGACC
ATGGAGTGGATCAAGGACGGGAACGAGGCCTGTGGCTGGCGGCGTGTGACGTATGAGGGGAGAGACGTCTTTCAA
GGGGAAGCTACCGACGGGGTGCCGCGTGTGGTTGAGGATACAGAGATGGAGTGA
Gene >Ophcf2|04028
ATGAAGGGCACTCGCTCTCGGCCTTCTGCCGCCGGCAAGAGGAAGTCTCCCGTGTCGCCCGGACAGCCGCCTCCG
TCGAAGCGATCCCTTAACGGGAGACTTACGTCGGATGATGCCGAGTTCGACGGCGACGACGACGGTGGCCTTCTT
GAAGAGGACTTTGAAGACGATGTTCACGACCACAACTCGTTGTATATTGATTCTCCCGGCAGCTTGGGCGAGTGG
CAGGACACGATCCAAAAGGTGGTCTGCAACGTCGTCGCCATCCGCTTCTGCCAGACATGCTCGTTCGATACCGAT
CCGGCTTTGACGAGCGAGGCCACCGGCTTCGTTGTTGACGCTCAACGAGGGTGCGTACGCGACCTCTCCGGCGCC
TCGTCGTCGTTGCTTTGCTGACGTCTTGTTCCTTGCTCTCGTCACAGATACATCATGACGAACCGACATGTCGTC
GGTGCAGGTCCCTTTTGGGGTCACTGCGTGTTTGACAATCACGAAGAAGTTGACTGCTATCCCGTCTATCGCGAT
CCCGTCCACGATTTTGGCATCTTGCGTTACGACCCAAAGGCCATCAAGTACATGCACGTCGACGGCTTGGACTTG
AGGCCGGACCAGGCCAAAGGTACGTGGTGCCCTGCTTTCGACGCCTTCAAAGGCCACTGGCTGACGCGAGATGTA
GTGGGCGTCGAGATCCGCGTCGTAGGCAACGATGCCGGCGAGAAACTCAGCATCCTGTCCGGCGTCATCAGCCGC
CTGGACCGCAACGCCCCCGAGTACGGCGAAGGATACAGCGACTTCAACACTTGCTACTACCAGGCCAACGCCGCG
GCTAGCGGTGGCAGCTCGGGCAGTCCCGTCGTCAGCAAGGACGGCGCGGCAGTGGCCCTACAGGCTGGCGGCCGC
TCAGACGGTGCATCGACGGACTACTTCCTCCCCCTGGACCGCCCCCTGCGAGCTCTGCAGTGCATCCAGCAGGGC
AAGCCCGTCACCCGCGGCGATATCCAGTGCCAGTTCCTGCTCAAACCCTTTGACGAGTGCCGTAGGCTGGGCCTC
AGTCCGCATTGGGAGGCGGCCATGCGCGAGGCCTTTCCCAACGAGACCAACCTGCTGGTGGCCGAGATCGTCCTC
GCGTCGGGCCCCTCGTGCGGTAAGATCGAGGAGGGCGACGTCTTGATCAAGGTCAACGGGGAGCTCATCACGCAA
TTCATCCGTCTCGACGACATCCTCGACGAAAACGTCGGCAAGTCGGTGACGGTCATGCTGCAGCGTGGTGGGCAG
GACGTGGCGGTCGAGATTGAGGTCGGCGACCTGCACCGCATCACGCCGGACCGCTTCGTCACCGTGGCCGGCGCG
AGCTTTCACAACCTGTCGTACCAGCAGGCCAGGCTGTATGCCGTGGCCGTTCAGGGCGTCTACGTCTGCGAGTCG
GCCGGCTCCTTCAGGTTCGACAACACGGACAACGGTTGGATCGTTCAGACCATCGACCACAAAAAGGTGCCCGAT
CTCGATGCCTTCATCGCCGTCATGAAGGCCATTCCCGACAAGGCGAGGGTGGTGGTGACGTACAAGCACCTCCGC
GACTTGCACACTCTCAACACGTCCGTCATCTACGTCGACCGTCACTGGTCCTCCAAGATGAAGATGGCCGTCCGC
AACGACAGCACCGGCCTATGGGACTTTTCCGACCTGGGCACCGCCCTTCCGCCCGTGCCGCCCGTCCGCCGCTCA
GCCTCGTTCATCGAGCTCGACCACATGCCGCACCCGGGCATCGCCGACCTCATCCGCAGCTTCGTCCACGTCAAC
TGCACCATGCCCGTCAAGCTCGACGGGTTCCCCAAGAACCGGCGTTGGGGGATGGGCCTCGTCATCGACGCCGAC
AAGGGCCTGGTGCTCATCTCTAGGGCTATCGTGCCCTACGACCTCTGCGACATCACCGTCACCATCGCCGACTCG
GTCATCGTCGAGGGCAAGGTCGTCTTCTTGCACCCGCTGCAGAACTACGCCATCATCCGCTACGATCCGGCCCTC
GTCGACGCGCCCGTCAAGAGCGCAACCATGAGCGGCGAGCATCTCACGCAGGGCGCCAAGACGTACTTCTTGGGC
CACAACCGCATAGGGCGCGTCGTCCACGGGGCCACTACGGTCACCGAGATCACGGCCGTCGCCATCCCGGCCAAC
TCGGGCGCGCCGCGGTACCGGGCCGTCAACGTCGACGCCATCACCATCGACAGCAACCTCGGGTCGACTTGCAAC
AGCGGCGTGCTGGTGTCTCCGGACGGCACCGTCCAGGCGCTGTGGCTGTCGTACCTGGGCGAGCGGTCGCCCTGC
AGCCAGCGGGACGAGGAGTACTATCTGGGGCTGGGCACGCCGACGCTGCTGCCCGTCATCGGCGCCATTCAGAAG
GGCGAGACGCCGCGACTGAGGATGCTGTCGGTCGAGCTGCGGTCGGTGCAGATGTCCCAGGCGCGCGTCATGGGC
GTCTCGGACGAATGGATCAAGAAGGTGACGCAGGCGAACCGATCTCACCACCAGCTCTTCATGGTCAGCAAGCGT
ACATTTGAGCGCGGCGAGCATCCCGTCTCCCTGCTCGAGGGCGACATCGTCCTCACGCTGAACGGCAAGATGTGC
ACCACCATCTCTGACTTTGACGTCATGTACACCAGCGAGGTGCTCGACGCCGTCATCGTCCGCGAGTGCGAGGAG
CTACGGCTGCAGCTACCGACGGTGGCCGCTACCGATATGGAGACGGATCACGCCGTCTCCTTCTGCGGCGCCGTT
CTGCATCGTCCGCACCAGGCTGTGCGGCAGCAGATCAGCAAGCTGCATAGCGAAGTCTACGTGTCGAGCCGCATC
CGGGGTTCGCCCGCCTATCAATATGGCGTCGCCCCGACCAACTTCATCACGCACGTCAACGGCCGCCCGACGCCG
GATCTCACTTCTTTCATCGCCGCCACGCGCGAGATTCCGGACAATACCTGTGAGTGGTTTCTCAATGCCCTTCCT
CTCTTTGTTTCGTTTGCGTTGCTGACTCAAAGTTTTCCAAGACTTTCGCCTCAAGGCCGTCACGTTTGATAGCGT
GCCGTGGGTGATTACGATGAAGAAGAACGACCACTACTTCCCGACCATGGAGTGGATCAAGGACGGGAACGAGGC
CTGTGGCTGGCGGCGTGTGACGTATGAGGGGAGAGACGTCTTTCAAGGGGAAGCTACCGACGGGGTGCCGCGTGT
GGTTGAGGATACAGAGATGGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail