Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04027
Gene name
Locationscaffold_04:668184..668587
Strand+
Gene length (bp)403
Transcript length (bp)267
Coding sequence length (bp)267
Protein length (aa) 89

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1262 0.9394 0.3555 0.0478 0.0278 0.0106 0.0206 0.0057 0.008 0.0007

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5149
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5806
Ophiocordyceps australis map64 (Brazil) OphauB2|2741
Ophiocordyceps camponoti-floridani Ophcf2|04027 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5733
Ophiocordyceps subramaniannii Hirsu2|3576

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04027
MEGRTTKSLQNMWTKIVKEIADIEAKDQGGDGQGTPTKPARKPAGAWTAVNCRTSSKRAPESSIKGDAPKKAKRS
GSDEKETDEAGSD*
Coding >Ophcf2|04027
ATGGAAGGCAGAACCACCAAGAGCCTTCAGAACATGTGGACCAAGATCGTCAAGGAGATTGCCGACATCGAGGCC
AAGGATCAGGGAGGCGATGGCCAGGGCACGCCCACCAAGCCCGCTCGCAAGCCCGCTGGGGCTTGGACCGCTGTT
AATTGTCGGACCTCTTCAAAGAGAGCCCCGGAGTCCTCCATCAAGGGTGACGCCCCCAAGAAAGCGAAGCGATCG
GGCTCGGATGAAAAGGAGACCGACGAGGCTGGCAGCGATTAA
Transcript >Ophcf2|04027
ATGGAAGGCAGAACCACCAAGAGCCTTCAGAACATGTGGACCAAGATCGTCAAGGAGATTGCCGACATCGAGGCC
AAGGATCAGGGAGGCGATGGCCAGGGCACGCCCACCAAGCCCGCTCGCAAGCCCGCTGGGGCTTGGACCGCTGTT
AATTGTCGGACCTCTTCAAAGAGAGCCCCGGAGTCCTCCATCAAGGGTGACGCCCCCAAGAAAGCGAAGCGATCG
GGCTCGGATGAAAAGGAGACCGACGAGGCTGGCAGCGATTAA
Gene >Ophcf2|04027
ATGGAAGGCAGAACCACCAAGAGCCTTCAGAACATGTGGACCAAGATCGTCAAGGAGATTGCCGACATCGAGGCC
AAGGATCAGGGAGGCGATGGCCAGGGCACGCGTGAGTCCAACGATGCTCACTCACACTCACTGCCTACGATCTTT
CCGCTAATTAGAGTCACCTTCCCAGCCACCAAGCCCGCTCGCAAGCCCGCTGGGGCTTGGACCGCTGTTAATTGT
CGGACCTCTTCAAAGAGAGCCCCGGGTGAGTCTCCTCTGCCTGTATGTCTTGCTGTTACAGTTGGCCAGGCTAAC
GGTCGTCGACTTGACAGAGTCCTCCATCAAGGGTGACGCCCCCAAGAAAGCGAAGCGATCGGGCTCGGATGAAAA
GGAGACCGACGAGGCTGGCAGCGATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail